Property Summary

NCBI Gene PubMed Count 100
Grant Count 65
R01 Count 38
Funding $12,115,335.51
PubMed Score 200.49
PubTator Score 122.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
interstitial lung disease -1.300 0.041
Multiple myeloma 1.842 0.000
astrocytic glioma 1.100 0.033
ependymoma 1.800 0.005
oligodendroglioma 1.700 0.003
psoriasis 1.500 0.000
osteosarcoma 2.005 0.001
atypical teratoid / rhabdoid tumor 1.200 0.001
group 4 medulloblastoma 1.500 0.001
medulloblastoma, large-cell 1.500 0.000
hereditary spastic paraplegia -1.098 0.019
lung cancer -1.400 0.001
lung adenocarcinoma 1.194 0.000
COPD -1.100 0.004
progressive supranuclear palsy -1.200 0.006
ovarian cancer -2.000 0.000
Gaucher disease type 1 -2.000 0.012
dermatomyositis -1.100 0.008

Synonym

Accession O00571 A8K538 B4E3E8 O15536
Symbols DBX
DDX3
HLP2
DDX14
CAP-Rf
MRX102

Gene

PDB

4O2C   4O2E   4O2F   2I4I   2JGN   3JRV   4PX9   4PXA   5E7I   5E7J   5E7M  

Gene RIF (108)

PMID Text
27012366 Our results suggest that the intrinsically disordered N-terminal domain of DDX3 regulates its functions in translation by acting prior to the recruitment of the 43S pre-initiation complex onto the viral 5'-UTR.
26598523 analysis of the structural and functional core of the DDX3 subfamily of DEAD-box proteins
26454002 The DDX3 may participate in antiviral innate immunity, at least in part, by translational control of interferon-induced protein kinase (PACT).
26337079 Data show that knockdown of RNA helicase DDX3 in breast cancer MCF-7 and MDA-MB-231 cells resulted in decreased proliferation rates.
26311743 Data show that high cytoplasmic DEAD-box helicase 3 (DDX3) expression correlated with nuclear beta-catenin expression, a marker of activated Wnt signaling.
26290144 The results do not support our hypothesis that common germline genetic variants in the DDX3X genes is associated with the risk of developing medulloblastoma.
26235985 Mutations in DDX3X are a common cause of unexplained intellectual disability with gender-specific effects on Wnt signaling.
26192917 T-cell lymphoma patients with DDX3X mutations presented a poor prognosis.
26174373 As such, DDX3 has been shown to play roles both upstream and downstream of I-kappa beta kinase epsilon (IKKepsilon)/TANK-binding kinase 1, leading to IFN-beta production.
26087195 Data show that DEAD-box helicase 3 (DDX3) had a significant prognostic predictive power in colorectal cancer at both RNA and protein level.
More...

AA Sequence

MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYS      1 - 70
SFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPL     71 - 140
PPSERLEQELFSGGNTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHA    141 - 210
IPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAV    211 - 280
QIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEAD    281 - 350
RMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVV    351 - 420
WVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSG    421 - 490
KSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLL    491 - 560
VEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGS    561 - 630
SRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN                                          631 - 662
//

Text Mined References (120)

PMID Year Title
27012366 2016 DEAD-box RNA helicase DDX3 connects CRM1-dependent nuclear export and translation of the HIV-1 unspliced mRNA through its N-terminal domain.
26598523 2016 Autoinhibitory Interdomain Interactions and Subfamily-specific Extensions Redefine the Catalytic Core of the Human DEAD-box Protein DDX3.
26454002 2016 DDX3 functions in antiviral innate immunity through translational control of PACT.
26337079 2015 NZ51, a ring-expanded nucleoside analog, inhibits motility and viability of breast cancer cells by targeting the RNA helicase DDX3.
26311743 2015 Identification of the DEAD box RNA helicase DDX3 as a therapeutic target in colorectal cancer.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26235985 2015 Mutations in DDX3X Are a Common Cause of Unexplained Intellectual Disability with Gender-Specific Effects on Wnt Signaling.
26192917 2015 Exome sequencing identifies somatic mutations of DDX3X in natural killer/T-cell lymphoma.
26174373 2015 RNA helicase DDX3: at the crossroad of viral replication and antiviral immunity.
26087195 2015 DDX3 as a strongest prognosis marker and its downregulation promotes metastasis in colorectal cancer.
More...