Property Summary

NCBI Gene PubMed Count 31
Grant Count 39
R01 Count 17
Funding $2,799,024.34
PubMed Score 100.00
PubTator Score 58.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 4 medulloblastoma -2.500 0.000
atypical teratoid/rhabdoid tumor 2.200 0.000
medulloblastoma, large-cell -2.800 0.000
adult high grade glioma -1.500 0.007

Gene RIF (23)

PMID Text
26782455 The results of the SRY gene amplification of plasma DNA from pregnant women was the same as that of the amniocyte DNA
26365194 The analysis identified a signaling axis between FGF signaling and the transcription factor Sox1, which is preferentially expressed in stem- and mesenchymal-like breast cancers.
26191244 downregulation of SOX-1 was correlated with poor prognosis and tumor development in hepatocellular carcinoma.
26040764 SOX 1 suppressed cell growth and invasion in Tu212 cells by inhibiting Wnt pathway, and the anti-tumor effect of SOX 1 could be weakened by SOX 2, which may be a potential molecular basis for clinical treatment of laryngeal squamous cell carcinoma .
25613070 Our results suggest that SOX1 is epigenetically silenced in the majority of NSCLC and restoration of SOX1 inhibited cell migration by regulating actin cytoskeletal remodeling in NSCLC.
25427424 SOX1 decreases the expression of beta-catenin in a proteasome-independent manner.
24799352 PAX1 and SOX1 DNA methylation correlate with a cervical intraepithelial neoplasia diagnosis.
24407576 The methylation index of SOX1 recovered from scrapings of uterine cervix adenocarcinomas is significantly higher than in normal controls.
24138016 we successfully established a three-step inducing protocol to derive Neural stem cells from adipose-derived mesenchymal stem cells with high purity by Sox1 activation
23994634 Inactivation of SOX1 gene is associated with cisplatin resistance in human non-small cell lung cancer cell.
More...

AA Sequence

MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMA      1 - 70
QENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKYSLAGG     71 - 140
LLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQ    141 - 210
LAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGA    211 - 280
AAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPA    281 - 350
GEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI                                 351 - 391
//

Text Mined References (32)

PMID Year Title
26782455 2015 Isolation and analysis of cell-free fetal DNA from maternal peripheral blood in Chinese women.
26365194 2015 Sox10 Regulates Stem/Progenitor and Mesenchymal Cell States in Mammary Epithelial Cells.
26191244 2015 Prognostic significance of SOX-1 expression in human hepatocelluar cancer.
26040764 2015 SOX 1, contrary to SOX 2, suppresses proliferation, migration, and invasion in human laryngeal squamous cell carcinoma by inhibiting the Wnt/?-catenin pathway.
25613070 2015 Epigenetic inactivation of SOX1 promotes cell migration in lung cancer.
25427424 2014 SOX1 down-regulates ?-catenin and reverses malignant phenotype in nasopharyngeal carcinoma.
25234806 2015 Dissecting the genetics of chronic mucus hypersecretion in smokers with and without COPD.
24799352 2014 PAX1/SOX1 DNA methylation and cervical neoplasia detection: a Taiwanese Gynecologic Oncology Group (TGOG) study.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24138016 2014 Generation of highly purified neural stem cells from human adipose-derived mesenchymal stem cells by Sox1 activation.
More...