Property Summary

NCBI Gene PubMed Count 35
PubMed Score 108.97
PubTator Score 58.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.500 7.3e-03
atypical teratoid / rhabdoid tumor 1.800 1.7e-02
group 3 medulloblastoma -2.300 2.1e-04
medulloblastoma, large-cell -2.800 3.0e-05

Gene RIF (27)

AA Sequence

MYSMMMETDLHSPGGAQAPTNLSGPAGAGGGGGGGGGGGGGGGAKANQDRVKRPMNAFMVWSRGQRRKMA      1 - 70
QENPKMHNSEISKRLGAEWKVMSEAEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLLKKDKYSLAGG     71 - 140
LLAAGAGGGGAAVAMGVGVGVGAAAVGQRLESPGGAAGGGYAHVNGWANGAYPGSVAAAAAAAAMMQEAQ    141 - 210
LAYGQHPGAGGAHPHAHPAHPHPHHPHAHPHNPQPMHRYDMGALQYSPISNSQGYMSASPSGYGGLPYGA    211 - 280
AAAAAAAAGGAHQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPA    281 - 350
GEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI                                 351 - 391
//

Text Mined References (36)

PMID Year Title