Property Summary

NCBI Gene PubMed Count 82
Grant Count 15
R01 Count 10
Funding $2,490,080.06
PubMed Score 209.86
PubTator Score 245.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.460 0.029
astrocytoma 1.200 0.020
glioblastoma 1.500 0.000
medulloblastoma, large-cell -1.100 0.006
Duchenne muscular dystrophy 1.230 0.000
autosomal dominant Emery-Dreifuss muscul... 1.243 0.002
lung cancer -1.400 0.000
diabetes mellitus -1.100 0.007
subependymal giant cell astrocytoma 1.894 0.018
lung carcinoma -1.300 0.000
ovarian cancer -2.100 0.000
dermatomyositis 1.500 0.001

Gene RIF (44)

PMID Text
26787460 Data suggest that syntenin/SDCBP PDZ domains 1 and 2 recognize a broad range of peptide ligands with preferences for nectin-1, hydrophobic amino acid motifs, and cryptic internal ligands/peptide fragments.
26561205 Data show that patients with high MDA-9/Syntenin and high Slug expressions were associated with poor overall survival compared to those with low expression in lung adenocarcinomas.
26093898 To predict mda-9's association with extracellular matrix organization.
25893292 these findings demonstrate that syntenin may act as an important positive regulator of TGF-b signaling by regulating caveolin-1-mediated internalization of TbRI; thus, providing a novel function for syntenin that is linked to cancer progression.
25480418 MDA-9, co-expressed with GRP78, as a melanoma protein associated with lymph node metastasis. Investigating how MDA-9 and GRP78 interact to contribute to melanoma metastasis and disease progression could reveal new potential avenues of targeted therapy
24662291 ALCAM stably interacts with actin by binding to syntenin-1 and ezrin.
24637612 Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2.
24305713 High MDA-9 expresison is associated with glioma.
23873690 Our findings indicate that MDA-9/Syntenin might provide an attractive target for developing detection, monitoring, and therapeutic strategies for managing Urothelial cell carcinoma .
23533663 Results suggested that SDCBP played an important role in tumor growth of ER-negative breast cancers.
More...

AA Sequence

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV      1 - 70
AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL     71 - 140
VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG    141 - 210
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK    211 - 280
RMAPSIMKSLMDHTIPEV                                                        281 - 298
//

Text Mined References (93)

PMID Year Title
27386966 2016 Frizzled 7 and PIP2 binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signalling.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26787460 2016 Proteomic peptide phage display uncovers novel interactions of the PDZ1-2 supramodule of syntenin.
26561205 2016 MDA-9/Syntenin-Slug transcriptional complex promote epithelial-mesenchymal transition and invasion/metastasis in lung adenocarcinoma.
26539120 2015 Syntenin controls migration, growth, proliferation, and cell cycle progression in cancer cells.
26291527 2016 MDA-9/Syntenin Control.
26093898 2015 Examination of Epigenetic and other Molecular Factors Associated with mda-9/Syntenin Dysregulation in Cancer Through Integrated Analyses of Public Genomic Datasets.
26032692 2015 Syntenin and syndecan in the biogenesis of exosomes.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25480418 2015 MDA-9 and GRP78 as potential diagnostic biomarkers for early detection of melanoma metastasis.
More...