Property Summary

NCBI Gene PubMed Count 78
PubMed Score 153.71
PubTator Score 74.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 1.4e-05
malignant mesothelioma 3163 2.2e-05
psoriasis 6685 7.6e-05
medulloblastoma, large-cell 6234 2.4e-04
Disease Target Count Z-score Confidence
Cancer 2346 3.898 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 2.2e-05
psoriasis -2.000 7.6e-05
medulloblastoma, large-cell -1.100 2.4e-04
ovarian cancer 1.700 1.4e-05

Gene RIF (65)

PMID Text
25773455 RCAS1 seems to be involved in creating tumor-induced inflammation in the tumor and its microenvironment
25674852 Findings suggest that the histological effect of increased RCAS1 expression depends on its cellular source and that RCAS1 expression itself is a component of various signaling pathways in urothelial bladder cancer cells.
25177692 Given the significant correlation between tumor ADAM9 expression and serum RCAS1 concentration in both cervical and endometrial cancer as well as the role for ADAM9 in RCAS1 shedding.
24885040 suggests that RCAS1 has an apoptotic function via membranous/soluble expression pattern in OSCC cells. RCAS1 may thus affect tumor escape from immune surveillance in OSCC by inducing apoptosis
24815841 RCAS1 could be a useful immunohistochemical biomarker, indicating not only tumor aggressiveness but also a poorer prognosis for patients with NSCLC.
24720371 High EBAG9 expression is associated with malignant pleural effusion in patients with lung cancer.
24119785 High EBAG9 expression is associated with tamoxifen resistance in breast cancer.
23881387 sRCAS1 levels could have a clinical value for the diagnosis and management of lung cancer and could be used as a new tumor marker of lung cancer.
23563217 The membrane molecule RCAS1 induces immune cell apoptosis via the RCAS1-RCAS1R pathway.
23164108 RCAS1 may play an important role in the phenomenon of tumor escape from host immunological surveillance and in creating the immune tolerance for the tumor cells, as well as in the tumor microenvironment.
22530960 The intensity of the suppressive profile of the cervical cancer microenvironment indicated by the presence of both RCAS1 and B7H4 on the front of the tumor and in the macrophages and fibroblasts infiltrating the cancer stroma
22460085 RCAS1 protein may participate in thyroid neoplastic transformation and could be considered as a useful biomarker to improve diagnostic scrutiny.
21845402 The immunoreactivity of RCAS1 on the cells present in the ovarian cancer microenvironment, was analysed.
21804460 Data suggest that RCAS1 may be involved in the early stages of tumor progression in mobile tongue squamous cell carcinoma.
20645939 We observed a statistically significant increase in the RCAS1-positive macrophage infiltration within the microenvironment of the molar lesions in patients with partial hydatidiform mole in comparison with those who exhibited complete hydatidiform mole.
20571277 analyzed RCAS-1 as a biomarker in the serum of patients with head and neck squamous cell carcinoma
20570965 EBAG9 acts as a negative regulator of a COPI-dependent ER-to-Golgi transport pathway in epithelial cells and shows pathogenetic principle in which interference with intracellular membrane trafficking results in the emergence of a tumor-associated glycome
20164540 NASP and RCAS1 proteins were more frequently expressed in ovarian cancer tissues than with normal ovarian tissue and serous cystadenomas and MRE11 was less frequently expressed
20079734 the RCAS1 putative receptor-expressing chronic myelogenous leukemia cell line K562 was co-cultured with SiSo, MCF-7, or soluble RCAS1 to follow RCAS1 secretion in apoptosis initiation
19957811 RCAS1 can be used as a serum tumor marker for diagnosis of pancreatic cancer.
19813143 We found expression of RCAS1 co-localizing with GFAP+ cells of gliomas and with CD68 and CD74 in large macrophages infiltrating metastatic and primary tumours and sometimes in cells which had morphological characteristics of microglia
19634109 RCAS1 has a role in advanced colonic neoplasms
19574770 RCAS1 expression is correlated with a decreasing number of vimentin-positive stromal cells in cervical cancer.
19337974 tissue RCAS1 expression...considered as an informative biomarker in several types of human malignancy
19122463 The lack of alterations in the sRCAS1 blood serum concentration levels observed in patients with adenomyosis may favor the development of the condition
19032612 The level of RCAS1 in the decidua seems to influence effectiveness of stillbirth induction.
19030177 EBAG9 may have a role in promoting progression of bladder cancer
18688918 In rheumatoid arthritis, the lack of RCAS1 is thought to induce CTL infiltration through loss of the ability to evade immune attack, thus leading to apoptosis of the synovial lining cells.
18292826 The lowest level of RCAS1 endometrial expression was found during the early secretory cycle phase, and significantly higher expression was found in the endometrium during the mid-secretory as compared to the early secretory cycle phase.
18032910 The presence of an enhanced number of immune cells of higher activity in ectopic decidua during the final step of decidualization seems to be associated with an increase in the immunoreactivity level of RCAS1.
17981616 RCAS1 is a bioactive marker that induces connective tissue remodeling and lymphocyte apoptosis [review]
17849467 RCAS1 may be a pivotal regulator of tumor growth through angiogenesis.
17845206 The limited immune cells infiltration in decidua during severe pre-eclampsia is associated with increase in RCAS1 decidual level.
17825484 Results show that the suppression of RCAS1 expression effectively recover T cell proliferation, reduce apoptosis and partially reverse the T cell function of IFN-gamma secretion.
17717421 the drop of the RCAS1 level, which could be a result of an insufficiency of the compensatory immune response mechanisms in tubal mucosa (although these mechanisms are simultaneously preserved in endometrium), leads to tubal perforation.
17604121 possible role of the RCAS1 protein in the development of pre-eclampsia through an immunological pathway.
17562271 The expression of RCAS1 in cervical cancer is significantly increased, and has correlation with malignant degree of cervical carcinoma. Some RCAS1-positive cervical cancer tissues are infected by HPV16.
17466050 High-level expression of RCAS1 is involved in the malignant transformation of endometrium, and RCAS1 coexpression with ER-alpha may be associated with development and metastasis of endometrial carcinoma
17250817 HIV-1 Tat significantly increases the mRNA transcription levels and the secretion of soluble RCAS1 in CD4(+) T cells and monocytes. Tat-mediated apoptosis is blocked by inhibiting the expression of RCAS1
17187008 RCAS1 expression was simultaneous to the infiltration of activated immunological cells of tumor environment as well as decidua. The activity of immunological cells was selectively suppressed.
17187007 Significantly higher RCAS1 expression was noticed in tumor in comparison to stroma in patients with the presence of lymph nodes metastases. No such difference was observed in patients without the metastases.
16907986 The expression of RCAS1 by endometrial cells may favor the persistence of these cells in ectopic localization both in scar following cesarean section and in ovarian endometriosis.
16595162 RCAS1 expression in gliomas may play roles in tumor progression and tumor immune escape.
16273616 metastatic lymph nodes from bile duct, gastric, colon and pancreatic cancer were investigated for RCAS1 expression
16211275 expression of RCAS1 is correlated with recurrence not only in carcinomas, but also in mesenchymal tumors
16175077 distribution of RCAS1 expression in normal female genital organs; significant positive correlation between age and RCAS1 expression; RCAS1 may affect metaplastic processes and tumor progression
16113565 RCAS1 and CAP may play a role in the downregulation of the maternal immune response during pregnancy and may participate in the initiation of the labor
16112176 RCAS1 may contribute to acquisition of malignant uterine cervical phenotypic characteristics including invasion, metastasis, and tumor growth via connective tissue remodeling.
16012715 RCAS1 expression is informative for the follow-up of malignant mesothelioma patients and sRCAS1 in pleural fluid may be useful for the diagnosis of malignant mesothelioma.
15904507 the estrogen-inducible EBAG9 gene-product and the 22-1-1 defined antigen are structurally and functionally separate antigens
15867365 EBAG9 is a crucial regulator of tumor progression and a potential prognostic marker for RCC.
15813909 Macrophages may negatively regulate erythropoiesis at least in part through the production of RCAS1 molecules.
15635093 EBAG9 and Snapin have roles in controlling exocytosis processes
15460847 Serum RCAS1 appears to be valuable as a diagnostic index for biliary carcinomas, as well as for evaluating the progression of cancers during therapy.
15254686 RCAS1 expression might be associated with progression of oral squamous cell carcinoma
15164121 wide distribution of EBAG9 and its relation to advanced disease suggest that this protein may play important roles in epithelial ovarian cancer
14981953 The mean survival of patients who had primary hepatocellular carcinoma with high RCAS1 protein expression was significantly longer than that of patients with low expression.
14534714 RCAS1 gene or protein expression may not correlate with tumor progression in esophageal squamous cell carcinoma
12888828 RCAS1 may have role endometrial cancer invasiveness; overexpression associated with significantly poorer prognosis
12845666 Overexpression of EBAG9 is correlated with advanced pathologic stages of prostate cancer
12774924 RCAS1 expressed on macrophages may play an important role in the induction of activated T-cell apoptosis in cases of HNL
12672804 modulates surface expression of tumor-associated, normally cryptic O-linked glycan structures and contributes indirectly to the antigenicity of tumor cells
12054692 RCAS1 is associated with ductal breast cancer progression
11992411 High expression of tumor-associated antigen RCAS1 in pancreatic ductal adenocarcinoma is an unfavorable prognostic marker
11705872 Overrepresentation of EBAG9 may play a specific role in early stages of breast carcinogenesis.

AA Sequence

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS      1 - 70
VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI     71 - 140
HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV    141 - 210
KLS                                                                       211 - 213
//

Text Mined References (90)

PMID Year Title
25773455 2015 Analysis of the intensity of immune cell infiltration and immunoreactivity of RCAS1 in diffuse large B-cell lymphoma of the palatine tonsil and its microenvironment.
25674852 2015 Expression of RCAS1 correlates with urothelial bladder cancer malignancy.
25177692 2014 A disintegrin and metalloproteinase 9 is involved in ectodomain shedding of receptor-binding cancer antigen expressed on SiSo cells.
24885040 2014 Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.
24815841 The clinical and pathological significance of RCAS1 expression as a prognostic biomarker in non-small cell lung cancer.
24720371 2015 Diagnostic value of soluble receptor-binding cancer antigen expressed on SiSo cells and carcinoembryonic antigen in malignant pleural effusion in patients with lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24119785 2013 Association of positive EBAG9 immunoreactivity with unfavorable prognosis in breast cancer patients treated with tamoxifen.
23881387 2014 Serum-soluble receptor-binding cancer antigen expressed on SiSo cells as a clinical marker in lung cancer.
23563217 2013 The membrane molecule RCAS1 induces immune cell apoptosis via the RCAS1-RCAS1R pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23164108 2012 [The involvement of RCAS1 in creating a suppressive tumor microenvironment in patients with pharyngeal squamous cell carcinoma].
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22530960 2012 The immunohistochemical analysis of antigens such as RCAS1 and B7H4 in the cervical cancer nest and within the fibroblasts and macrophages infiltrating the cancer microenvironment.
22460085 2012 Receptor-binding cancer antigen expressed on SiSo cells (RCAS1) expression in human benign and malignant thyroid lesions.
21845402 2011 The analysis of receptor-binding cancer antigen expressed on SiSo cells (RCAS1) immunoreactivity within the microenvironment of the ovarian cancer lesion relative to the applied therapeutic strategy.
21804460 2011 RCAS1 expression in mobile tongue squamous cell carcinoma: an immunohistochemical study.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20645939 2011 The immunohistochemical analysis of RCAS1, HLA-G, and B7H4-positive macrophages in partial and complete hydatidiform mole in both applied therapeutic surgery and surgery followed by chemotherapy.
20571277 2010 RCAS-1 serum and tumor levels in head and neck squamous cell carcinoma.
20570965 2010 Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.
20164540 2010 Analysis of the expression of human tumor antigens in ovarian cancer tissues.
20079734 2010 Receptor-binding cancer antigen expressed on SiSo cells induces apoptosis via ectodomain shedding.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19957811 2009 [Evaluation of RCAS1 as serum tumor marker for pancreatic cancer].
19813143 2009 Expression of RCAS1 protein in microglia/macrophages accompanying brain tumours. An immunofluorescence study.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19634109 Diagnostic and prognostic utility of serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) levels in colon cancer patients.
19574770 2009 The level of RCAS1 expression is inversely correlated with the number of vimentin-positive stromal cells in epithelial ovarian cancer.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19337974 2009 Receptor-binding cancer antigen expressed on SiSo cells (RCAS1): a novel biomarker in the diagnosis and prognosis of human neoplasia.
19122463 2009 Alterations in RCAS1 serum concentration levels during menstrual cycle in patients with uterine leiomyoma and lack of analogical changes in adenomyosis.
19032612 2008 RCAS1 decidual immunoreactivity during stillbirth: immune cell presence and activity.
19030177 2009 EBAG9 is a tumor-promoting and prognostic factor for bladder cancer.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18688918 2008 Downregulation of RCAS1 and upregulation of cytotoxic T cells affects synovial proliferation and apoptosis in rheumatoid arthritis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18292826 2007 The differences in RCAS1 and DFF45 endometrial expression between late proliferative, early secretory, and mid-secretory cycle phases.
18088087 2008 Phosphoproteome of resting human platelets.
18032910 2008 RCAS1 decidual immunoreactivity during cesarean section in scar deciduosis: immune cell presence and activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981616 2008 The biological role of the unique molecule RCAS1: a bioactive marker that induces connective tissue remodeling and lymphocyte apoptosis.
17849467 2007 Biologic significance of receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a pivotal regulator of tumor growth through angiogenesis in human uterine cancer.
17845206 2007 RCAS1 decidual immunoreactivity in severe pre-eclampsia: immune cell presence and activity.
17825484 2007 Knockdown of RCAS1 expression by RNA interference recovers T cell growth and proliferation.
17717421 2008 Analysis of metallothionein, RCAS1 immunoreactivity regarding immune cell concentration in the endometrium and tubal mucosa in ectopic pregnancy during the course of tubal rupture.
17604121 2008 The human tumor-associated antigen RCAS1 in pregnancies complicated by pre-eclampsia.
17562271 2007 [Correlation of RCAS1 expression to human papillomavirus 16 (HPV16) infection in cervical cancer].
17516841 2007 Mid-region parathyroid hormone-related protein (PTHrP) and gene expression of MDA-MB231 breast cancer cells.
17466050 Expression of receptor-binding cancer antigen expressed on SiSo cells and estrogen receptor subtypes in the normal, hyperplastic, and carcinomatous endometrium.
17187008 2006 The characterization of the exposure to immune mediated apoptosis and the regulation of immune cytotoxic activity in the environment of a neoplasm and in decidua.
17187007 2006 The metallothionein and RCAS1 expression analysis in breast cancer and adjacent tissue regarding the immune cells presence and their activity.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16907986 2006 Comparison of RCAS1 and metallothionein expression and the presence and activity of immune cells in human ovarian and abdominal wall endometriomas.
16595162 2007 Clinico-pathological significance of RCAS1 expression in gliomas: a potential mechanism of tumor immune escape.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16273616 2005 Receptor-binding cancer antigen expressed on SiSo cells can be detected in metastatic lymph nodes from gastrointestinal cancers.
16211275 2005 A clinical and immunohistochemical study on gastrointestinal mesenchymal tumor (GIMT): RCAS1 as a predictor for recurrence of GIMT.
16175077 2005 Expression of RCAS1 in female genital organs.
16113565 The Role of RCAS1 and oxytocinase in immune tolerance during pregnancy.
16112176 2005 Invasive potency related to RCAS1 expression in uterine cervical cancer.
16012715 2005 Clinical significance of the expression of tumor-associated antigen, RCAS1, and its soluble protein in pleural fluid in malignant mesothelioma.
15904507 2005 Reevaluation of the 22-1-1 antibody and its putative antigen, EBAG9/RCAS1, as a tumor marker.
15867365 2005 Estrogen receptor-binding fragment-associated antigen 9 is a tumor-promoting and prognostic factor for renal cell carcinoma.
15813909 2005 A novel mechanism in suppression of erythropoiesis during inflammation: a crucial role of RCAS1.
15635093 2005 EBAG9 adds a new layer of control on large dense-core vesicle exocytosis via interaction with Snapin.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15460847 2004 Movement of a novel serum tumour marker, RCAS1, in patients with biliary diseases.
15254686 2004 Expression of RCAS1 and its function in human squamous cell carcinoma of the oral cavity.
15164121 2004 Expression of EBAG9/RCAS1 is associated with advanced disease in human epithelial ovarian cancer.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14981953 Gene and protein expression of RCAS1 in hepatocellular carcinoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14534714 Protein and gene expression of tumor-associated antigen RCAS1 in esophageal squamous cell carcinoma.
14514780 2003 Upregulation of tumour associated antigen RCAS1 is implicated in high stages of colorectal cancer.
12888828 2003 Association between RCAS1 expression and clinical outcome in uterine endometrial cancer.
12845666 2003 EBAG9/RCAS1 expression and its prognostic significance in prostatic cancer.
12774924 2003 Expression of apoptosis-associated protein RCAS1 in macrophages of histiocytic necrotizing lymphadenitis.
12672804 2003 The Golgi protein RCAS1 controls cell surface expression of tumor-associated O-linked glycan antigens.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138241 2002 RCAS1 expression: a potential prognostic marker for adenocarcinomas of the lung.
12054692 2002 RCAS1 is associated with ductal breast cancer progression.
11743045 2001 Immunohistochemical analysis of RCAS1 in human pituitary adenomas.
11435298 2001 Receptor binding cancer antigen expressed on SiSo cells, a novel regulator of apoptosis of erythroid progenitor cells.
11298137 2001 Expression of RCAS1 and FasL in human trophoblasts and uterine glands during pregnancy: the possible role in immune privilege.
10873660 2000 Promoter analysis and chromosomal mapping of human EBAG9 gene.
10426319 1999 Inhibition of cell growth and induction of apoptotic cell death by the human tumor-associated antigen RCAS1.
9418891 1998 Isolation of estrogen-responsive genes with a CpG island library.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.