Property Summary

NCBI Gene PubMed Count 78
Grant Count 5
Funding $981,716
PubMed Score 153.71
PubTator Score 74.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -2.000 0.000
medulloblastoma, large-cell -1.100 0.000
ovarian cancer 1.700 0.000

Gene RIF (65)

PMID Text
25773455 RCAS1 seems to be involved in creating tumor-induced inflammation in the tumor and its microenvironment
25674852 Findings suggest that the histological effect of increased RCAS1 expression depends on its cellular source and that RCAS1 expression itself is a component of various signaling pathways in urothelial bladder cancer cells.
25177692 Given the significant correlation between tumor ADAM9 expression and serum RCAS1 concentration in both cervical and endometrial cancer as well as the role for ADAM9 in RCAS1 shedding.
24885040 suggests that RCAS1 has an apoptotic function via membranous/soluble expression pattern in OSCC cells. RCAS1 may thus affect tumor escape from immune surveillance in OSCC by inducing apoptosis
24815841 RCAS1 could be a useful immunohistochemical biomarker, indicating not only tumor aggressiveness but also a poorer prognosis for patients with NSCLC.
24720371 High EBAG9 expression is associated with malignant pleural effusion in patients with lung cancer.
24119785 High EBAG9 expression is associated with tamoxifen resistance in breast cancer.
23881387 sRCAS1 levels could have a clinical value for the diagnosis and management of lung cancer and could be used as a new tumor marker of lung cancer.
23563217 The membrane molecule RCAS1 induces immune cell apoptosis via the RCAS1-RCAS1R pathway.
23164108 RCAS1 may play an important role in the phenomenon of tumor escape from host immunological surveillance and in creating the immune tolerance for the tumor cells, as well as in the tumor microenvironment.
More...

AA Sequence

MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS      1 - 70
VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI     71 - 140
HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV    141 - 210
KLS                                                                       211 - 213
//

Text Mined References (90)

PMID Year Title
25773455 2015 Analysis of the intensity of immune cell infiltration and immunoreactivity of RCAS1 in diffuse large B-cell lymphoma of the palatine tonsil and its microenvironment.
25674852 2015 Expression of RCAS1 correlates with urothelial bladder cancer malignancy.
25177692 2014 A disintegrin and metalloproteinase 9 is involved in ectodomain shedding of receptor-binding cancer antigen expressed on SiSo cells.
24885040 2014 Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.
24815841 The clinical and pathological significance of RCAS1 expression as a prognostic biomarker in non-small cell lung cancer.
24720371 2015 Diagnostic value of soluble receptor-binding cancer antigen expressed on SiSo cells and carcinoembryonic antigen in malignant pleural effusion in patients with lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24119785 2013 Association of positive EBAG9 immunoreactivity with unfavorable prognosis in breast cancer patients treated with tamoxifen.
23881387 2014 Serum-soluble receptor-binding cancer antigen expressed on SiSo cells as a clinical marker in lung cancer.
23563217 2013 The membrane molecule RCAS1 induces immune cell apoptosis via the RCAS1-RCAS1R pathway.
More...