Property Summary

NCBI Gene PubMed Count 80
Grant Count 111
R01 Count 74
Funding $16,172,455.75
PubMed Score 1168.85
PubTator Score 227.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.900 0.007
ependymoma 2.900 0.020
oligodendroglioma 3.100 0.006
medulloblastoma, large-cell -2.000 0.002
primitive neuroectodermal tumor 2.100 0.005
juvenile dermatomyositis 1.214 0.000
adrenocortical carcinoma -1.241 0.023
group 3 medulloblastoma 1.600 0.019
pilocytic astrocytoma 1.200 0.005
lung adenocarcinoma -1.300 0.000
psoriasis -1.400 0.000
Breast cancer -1.200 0.000
chronic rhinosinusitis -1.246 0.027

Synonym

Accession O00548 B2RAK7 B5M0B3 Q9NU41 Q9UJV2
Symbols DL1
Delta
DELTA1

Gene

PDB

4XBM  

Gene RIF (56)

PMID Text
26014475 altered Notch signaling via methylation of DLL1 is likely involved in possible disease-related mechanisms of early onset preeclampsia
25715738 determined the X-ray crystal structure of the extracellular domain of the Notch ligand delta-like ligand-1 (Dll-1)
25367118 Delta-like 1-mediated Notch signaling enhances the in vitro conversion of human memory CD4 T cells into FOXP3-expressing regulatory T cells.
25041739 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-beta signalling pathway.
24714813 Notch ligand Dll1 may enhance the adhesion and metastasis of melanoma cells by upregulation of N-cadherin.
24243972 Although Delta1 activates signal transducer and activator of transcription 3 signaling similarly to the gp130-activating cytokine interleukin-6 (IL-6), it has opposite effects on myeloid cell production.
24025447 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
23839946 direct measurement of the binding affinity of Notch1 EGF repeats 6-15 for Dll1 and Dll4 revealed that Dll4 binds with at least an order of magnitude higher affinity than Dll1
23769341 Data suggest that overexpression of Delta-Like1 (DLL1) in small cell lung cancer may increase the sensitivity of cells to chemotherapeutic agents.
23327670 MiR-34a reduced cell proliferation and invasiveness, at least, partially through its inhibitory effect on DLL1 in choriocarcinoma.
More...

AA Sequence

MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQAS      1 - 70
VSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENP     71 - 140
ERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEK    141 - 210
VCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGW    211 - 280
GGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSY    281 - 350
SCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC    351 - 420
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPC    421 - 490
HNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLL    491 - 560
GCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKN    561 - 630
GFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSK    631 - 700
DTKYQSVYVISEEKDECVIATEV                                                   701 - 723
//

Text Mined References (80)

PMID Year Title
26014475 2015 Alteration of Delta-like ligand 1 and Notch 1 receptor in various placental disorders with special reference to early onset preeclampsia.
25715738 2015 Notch ligand delta-like1: X-ray crystal structure and binding affinity.
25367118 2014 Delta-like 1-mediated Notch signaling enhances the in vitro conversion of human memory CD4 T cells into FOXP3-expressing regulatory T cells.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25041739 2015 Dengue virus up-regulates expression of notch ligands Dll1 and Dll4 through interferon-? signalling pathway.
24714813 2014 Notch ligand Delta-like 1 promotes the metastasis of melanoma by enhancing tumor adhesion.
24243972 2014 Blood stem cell fate regulation by Delta-1-mediated rewiring of IL-6 paracrine signaling.
24025447 2013 Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.
23839946 2013 Intrinsic selectivity of Notch 1 for Delta-like 4 over Delta-like 1.
23769341 2013 [Up-regulation of DLL1 may promote the chemotherapeutic sensitivity in small cell lung cancer].
More...