Property Summary

NCBI Gene PubMed Count 88
PubMed Score 1190.18
PubTator Score 227.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.241 2.3e-02
astrocytic glioma 2.900 7.0e-03
Astrocytoma, Pilocytic 1.200 4.0e-03
Breast cancer -1.200 2.4e-04
chronic rhinosinusitis -1.246 2.7e-02
ependymoma 2.900 2.0e-02
group 3 medulloblastoma 1.600 1.9e-02
juvenile dermatomyositis 1.214 5.0e-12
lung adenocarcinoma -1.300 5.9e-06
medulloblastoma, large-cell -2.000 2.2e-03
oligodendroglioma 3.100 5.7e-03
primitive neuroectodermal tumor 2.100 5.3e-03
psoriasis -1.400 1.6e-10

Protein-protein Interaction (3)

Gene RIF (64)

AA Sequence

MGSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQAS      1 - 70
VSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENP     71 - 140
ERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEK    141 - 210
VCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNCQEGW    211 - 280
GGLFCNQDLNYCTHHKPCKNGATCTNTGQGSYTCSCRPGYTGATCELGIDECDPSPCKNGGSCTDLENSY    281 - 350
SCTCPPGFYGKICELSAMTCADGPCFNGGRCSDSPDGGYSCRCPVGYSGFNCEKKIDYCSSSPCSNGAKC    351 - 420
VDLGDAYLCRCQAGFSGRHCDDNVDDCASSPCANGGTCRDGVNDFSCTCPPGYTGRNCSAPVSRCEHAPC    421 - 490
HNGATCHERGHRYVCECARGYGGPNCQFLLPELPPGPAVVDLTEKLEGQGGPFPWVAVCAGVILVLMLLL    491 - 560
GCAAVVVCVRLRLQKHRPPADPCRGETETMNNLANCQREKDISVSIIGATQIKNTNKKADFHGDHSADKN    561 - 630
GFKARYPAVDYNLVQDLKGDDTAVRDAHSKRDTKCQPQGSSGEEKGTPTTLRGGEASERKRPDSGCSTSK    631 - 700
DTKYQSVYVISEEKDECVIATEV                                                   701 - 723
//

Text Mined References (88)

PMID Year Title