Property Summary

NCBI Gene PubMed Count 34
PubMed Score 1075.28
PubTator Score 37.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.5e-02
pituitary cancer 1.200 5.4e-03
psoriasis 1.700 3.5e-04

 GO Function (1)

Gene RIF (13)

AA Sequence

MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDI      1 - 70
RFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSM     71 - 140
CFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYAFSHD    141 - 210
HPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALS    211 - 280
ASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSF    281 - 350
GGEVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSVIGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLP    351 - 420
PHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEEEEEDDNNEGDGDEEGENEEEEEDAEAGSEK    421 - 490
EEEARLAALEEQRMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIR    491 - 560
EANKLAEKRKAHDEAVRSEKKAKKARPE                                              561 - 588
//

Text Mined References (41)

PMID Year Title