Property Summary

NCBI Gene PubMed Count 32
Grant Count 63
R01 Count 31
Funding $14,684,926.93
PubMed Score 970.59
PubTator Score 37.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.700 0.000
non primary Sjogren syndrome sicca 1.100 0.015
pituitary cancer 1.200 0.005

Synonym

Accession O00541 Q6IC29
Symbols PES

Gene

PDB

2EP8  

Gene RIF (11)

PMID Text
25825154 The DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3' end formation of 47S rRNA independently of the PeBoW-complex.
24376209 PES1 may play important role in the progression of ovarian cancer by inversely regulating the ERalpha and ERbeta expression.
23333390 these results uncover a potential role of PES1 in chemoresistance by regulating DNA damage response in colorectal cancer cells.
22860098 Upstream of c-Jun, it was revealed that c-Jun NH2-terminal kinases (JNK) is essential for controlling PES1 expression
22820289 expression of PES1 correlated positively with ERalpha expression and negatively with ERbeta expression and predicted good clinical outcome in breast cancer
20011973 The physical interaction between B23 and PES1 implies that they may participate in ribosome biogenesis in a protein complex.
19764998 pescadillo might play a role in promoting the proliferation and carcinogenesis of human breast cancer, and thereby might be a potential target for human breast cancer treatment.
17353269 Results describe the role of PeBoW-specific proteins Pes1, Bop1, and WDR12 in complex assembly and stability, nucleolar transport, and pre-ribosome association.
16043514 Pes1 and Bop1 form a stable complex with a novel member, WDR12 (PeBoW complex).
15467761 RRB1 interacts with YPH1 (yeast pescadillo homologue 1) and other members of the Yph1 complex
More...

AA Sequence

MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKHKKKVNKGSTAARTFYLIKDI      1 - 70
RFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSM     71 - 140
CFLFSTFPRTGKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIVWITPYAFSHD    141 - 210
HPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALS    211 - 280
ASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSF    281 - 350
GGEVSWDKSLCIGATYDVTDSRITHQIVDRPGQQTSVIGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLP    351 - 420
PHLSPFVTEKEGDYVPPEKLKLLALQRGEDPGNLNESEEEEEEDDNNEGDGDEEGENEEEEEDAEAGSEK    421 - 490
EEEARLAALEEQRMEGKKPRVMAGTLKLEDKQRLAQEEESEAKRLAIMMMKKREKYLYQKIMFGKRRKIR    491 - 560
EANKLAEKRKAHDEAVRSEKKAKKARPE                                              561 - 588
//

Text Mined References (38)

PMID Year Title
25825154 2015 DEAD-box helicase DDX27 regulates 3' end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24376209 2013 PES1 differentially regulates the expression of ER? and ER? in ovarian cancer.
23333390 2013 PES1 regulates sensitivity of colorectal cancer cells to anticancer drugs.
22860098 2012 Transcriptional regulation of PES1 expression by c-Jun in colon cancer.
22820289 2012 PES1 promotes breast cancer by differentially regulating ER? and ER?.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...