Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.25
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 9.8420105367948E-14
nasopharyngeal carcinoma 1056 4.67952325419542E-9
pilocytic astrocytoma 3086 4.07298560466781E-7
Breast cancer 3099 6.88177839573411E-7
posterior fossa group A ependymoma 1511 9.14569131455923E-7
malignant mesothelioma 3163 1.40323455754402E-5
lung cancer 4473 3.2418637093875E-5
psoriasis 6685 2.39070515520768E-4
osteosarcoma 7933 0.0034748021591322
glioblastoma 5572 0.00424908891396197
subependymal giant cell astrocytoma 2287 0.0115226090395844
group 3 medulloblastoma 2254 0.0204818314611054
medulloblastoma, large-cell 6234 0.0207036217842833
astrocytoma 1493 0.0213138568566543
colon cancer 1475 0.0272427049439768
Disease Target Count Z-score Confidence
Nasopharynx carcinoma 19 3.356 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
psoriasis -1.400 0.000
osteosarcoma -1.767 0.003
posterior fossa group A ependymoma 1.300 0.000
astrocytoma 1.200 0.021
glioblastoma 1.600 0.004
group 3 medulloblastoma 1.700 0.020
medulloblastoma, large-cell -1.200 0.021
non-small cell lung cancer -1.232 0.000
colon cancer -2.100 0.027
lung cancer 2.300 0.000
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.658 0.012
nasopharyngeal carcinoma -1.300 0.000
Breast cancer -1.500 0.000

Synonym

Accession O00534 Q6UN19 Q6UN20 Q9BVF8
Symbols BCSC1
BCSC-1
LOH11CR2A

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Xenopus OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (3)

PMID Text
22594792 BCSC-1 binds to Sox10, which down regulates MITF, and results in a switch of melanoma cells from a proliferative to a migratory phenotype.
21803008 LOH11CR2A, PIG8 and CHEK1 are candidate tumor suppressor genes associated with breast carcinoma and have significant clinical as well as prognostic importance.
19656157 BCSC-1 suppression might play roles in tumorigenesis of some nasopharyngeal carcinomas

AA Sequence

MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG      1 - 70
KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA     71 - 140
LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED    141 - 210
KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG    211 - 280
EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM    281 - 350
EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG    351 - 420
IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV    421 - 490
IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG    491 - 560
LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK    561 - 630
ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL    631 - 700
AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA    701 - 770
AITFLKSSVDPAIFAF                                                          771 - 786
//

Text Mined References (11)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22594792 2012 Breast cancer suppressor candidate-1 (BCSC-1) is a melanoma tumor suppressor that down regulates MITF.
21803008 2011 Frequent alterations of LOH11CR2A, PIG8 and CHEK1 genes at chromosomal 11q24.1-24.2 region in breast carcinoma: clinical and prognostic implications.
21782286 2011 A genome-wide association study of aging.
19656157 2009 Tumor suppressor function of BCSC-1 in nasopharyngeal carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14504409 2003 The BCSC-1 locus at chromosome 11q23-q24 is a candidate tumor suppressor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9417908 1997 Molecular cloning and characterization of LOH11CR2A, a new gene within a refined minimal region of LOH at 11q23.
More...