Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.25
PubTator Score 9.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.200 2.1e-02
Astrocytoma, Pilocytic 1.600 4.3e-07
Breast cancer -1.500 6.9e-07
colon cancer -2.100 2.7e-02
ependymoma 1.100 7.4e-05
glioblastoma 1.600 4.2e-03
group 3 medulloblastoma 1.700 2.0e-02
lung cancer 1.200 2.6e-03
malignant mesothelioma 1.700 1.4e-05
medulloblastoma, large-cell -1.200 2.1e-02
nasopharyngeal carcinoma -1.300 4.7e-09
non-small cell lung cancer -1.232 9.8e-14
osteosarcoma -1.767 3.5e-03
psoriasis -1.400 2.4e-04
subependymal giant cell astrocytoma 1.396 4.5e-02

Synonym

Accession O00534 Q6UN19 Q6UN20 Q9BVF8
Symbols BCSC1
BCSC-1
LOH11CR2A

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG      1 - 70
KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA     71 - 140
LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED    141 - 210
KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG    211 - 280
EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM    281 - 350
EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG    351 - 420
IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV    421 - 490
IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG    491 - 560
LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK    561 - 630
ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL    631 - 700
AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA    701 - 770
AITFLKSSVDPAIFAF                                                          771 - 786
//

Text Mined References (11)

PMID Year Title