Property Summary

NCBI Gene PubMed Count 40
PubMed Score 1847.20
PubTator Score 80.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
Breast cancer 3099 7.74117218596916E-34
breast carcinoma 1614 1.88450691990461E-26
malignant mesothelioma 3163 8.47623217942609E-9
medulloblastoma, large-cell 6234 8.79563190836302E-8
psoriasis 6685 1.21777340125309E-7
lung cancer 4473 1.68712941668578E-7
posterior fossa group A ependymoma 1511 2.49283253611515E-6
atypical teratoid / rhabdoid tumor 4369 5.7820630767909E-6
nasopharyngeal carcinoma 1056 9.54849501609294E-5
colon cancer 1475 9.65905430801411E-5
oligodendroglioma 2849 1.02611817128527E-4
sonic hedgehog group medulloblastoma 1482 1.81416984292805E-4
invasive ductal carcinoma 2950 3.27415482494455E-4
ductal carcinoma in situ 1745 0.00102301390031825
nephrosclerosis 329 0.00240211631025578
osteosarcoma 7933 0.00271888712838584
Atopic dermatitis 944 0.00612234355175759
pilocytic astrocytoma 3086 0.00795543938143897
astrocytic glioma 2241 0.00955251772162665
pituitary cancer 1972 0.00990789216527561
Pick disease 1893 0.0135282713823945
glioblastoma 5572 0.0140011966789225
interstitial cystitis 2299 0.0456611769807807
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
3p- syndrome 21

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.119 0.002
malignant mesothelioma -6.200 0.000
astrocytic glioma -2.200 0.010
posterior fossa group A ependymoma -2.600 0.000
psoriasis -2.500 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -3.922 0.003
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
glioblastoma -1.800 0.014
medulloblastoma, large-cell -3.700 0.000
Atopic dermatitis -1.100 0.006
lung cancer 5.400 0.000
colon cancer -2.300 0.000
interstitial cystitis 1.200 0.046
pilocytic astrocytoma 1.200 0.008
nasopharyngeal carcinoma -2.200 0.000
breast carcinoma -2.100 0.000
Pick disease -1.700 0.014
Breast cancer -4.200 0.000
ductal carcinoma in situ -2.200 0.001
invasive ductal carcinoma -3.000 0.000
pituitary cancer -1.500 0.010

Synonym

Accession O00533 B7ZL03 Q2M3G2 Q59FY0
Symbols CALL
L1CAM2

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (24)

PMID Text
25943212 CHL1 expression patient-derived lymphoblasts correlated with clinical outcome in depressive disorder patients.
24971532 Our data collectively indicate that miR-182 in PTC promotes cell proliferation and invasion through direct suppression of CHL1, supporting the potential utility of miR-182 inhibition as a novel therapeutic strategy against PTC.
24512353 There was no statistical association between polymorphisms of the CHL1 gene and idiopathic scoliosis in a Chinese population.
24288179 our findings suggest that miR-590-5p acts as an oncogene by targeting the CHL1 gene and promotes cervical cancer proliferation
24203666 In 1 of 113 Colombian children with refractory epilepsy, MLPA showed a subtelomeric duplication of exon 3 of CHL1, also present in 2 relatives.
23906755 CHL1 has a role in human breast tumorigenesis and progression
23857787 The rs2272522 polymorphism (in the CHL1 gene) was found to exhibit a highly significant association with schizophrenia in the Qatari population.
22988240 BACE1(-/-) axon guidance defects are likely the result of abrogated BACE1 processing of CHL1 and BACE1 deficiency produces a CHL1 loss-of-function phenotype
22909203 The miRNA miR-151-3p had 6.7-fold higher basal expression in paroxetine-sensitive LCLs. This corresponds with lower expression of CHL1, a target of miR-151-3p
22744455 Overall, our study found a significant association of IL-17RC gene polymorphisms with AIS in a Chinese Han population, indicating IL-17RC gene may be as a susceptibility gene for AIS.
More...

AA Sequence

MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWT      1 - 70
KDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDP     71 - 140
LEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPR    141 - 210
LRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGD    211 - 280
LPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGIL    281 - 350
LCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVD    351 - 420
VRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAG    421 - 490
SYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFE    491 - 560
INGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRL    561 - 630
TWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQP    631 - 700
SDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTL    701 - 770
RVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHG    771 - 840
RLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQ    841 - 910
TPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHL    911 - 980
SNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPIEVFEPGAEHIVRLMTK    981 - 1050
NWGDNDSIFQDVIETRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLH   1051 - 1120
PDPEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGAYAGSKE   1121 - 1190
KGSVESNGSSTATFPLRA                                                       1191 - 1208
//

Text Mined References (42)

PMID Year Title
25943212 2015 CHL1, ITGB3 and SLC6A4 gene expression and antidepressant drug response: results from the Munich Antidepressant Response Signature (MARS) study.
24971532 2014 miR-182 targets CHL1 and controls tumor growth and invasion in papillary thyroid carcinoma.
24512353 2014 Lack of association between the CHL1 gene and adolescent idiopathic scoliosis susceptibility in Han Chinese: a case-control study.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24288179 2014 MicroRNA-590 promotes cervical cancer cell growth and invasion by targeting CHL1.
24203666 2013 [Detection of subtelomeric rearrangements due to MLPA in paediatric patients with refractory epilepsy in Colombia: the role of the CHL1 gene in pharmacoresistance].
23906755 2013 CHL1 is involved in human breast tumorigenesis and progression.
23857787 2013 Significant association of close homologue of L1 gene polymorphism rs2272522 with schizophrenia in Qatar.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...