Property Summary

NCBI Gene PubMed Count 41
PubMed Score 1884.23
PubTator Score 80.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Schizophrenia 1160 4.126 2.1
Intellectual disability 1016 0.0 0.0
Disease Target Count
3p- syndrome 21

Expression

  Differential Expression (23)

Disease log2 FC p
Breast cancer -4.200 7.7e-34
astrocytic glioma -2.200 9.6e-03
Astrocytoma, Pilocytic 1.200 9.4e-03
Atopic dermatitis -1.100 6.1e-03
atypical teratoid / rhabdoid tumor -4.700 5.8e-06
breast carcinoma -2.100 1.9e-26
colon cancer -2.300 9.7e-05
ductal carcinoma in situ -2.200 1.0e-03
ependymoma -2.400 3.7e-02
glioblastoma -1.800 1.4e-02
interstitial cystitis 1.200 4.6e-02
invasive ductal carcinoma -3.000 3.3e-04
lung cancer 3.500 4.9e-06
malignant mesothelioma -6.200 8.5e-09
medulloblastoma -2.000 1.5e-02
medulloblastoma, large-cell -3.700 8.8e-08
nasopharyngeal carcinoma -2.200 9.5e-05
nephrosclerosis -1.119 2.4e-03
oligodendroglioma -1.200 1.0e-04
osteosarcoma -3.922 2.7e-03
Pick disease -1.700 1.4e-02
pituitary cancer -1.500 9.9e-03
psoriasis -2.500 1.2e-07

 GO Function (1)

Gene RIF (25)

AA Sequence

MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWT      1 - 70
KDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDP     71 - 140
LEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPR    141 - 210
LRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGD    211 - 280
LPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGIL    281 - 350
LCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVD    351 - 420
VRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAG    421 - 490
SYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFE    491 - 560
INGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRL    561 - 630
TWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQP    631 - 700
SDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTL    701 - 770
RVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHG    771 - 840
RLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQ    841 - 910
TPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHL    911 - 980
SNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPIEVFEPGAEHIVRLMTK    981 - 1050
NWGDNDSIFQDVIETRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLH   1051 - 1120
PDPEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGAYAGSKE   1121 - 1190
KGSVESNGSSTATFPLRA                                                       1191 - 1208
//

Text Mined References (43)

PMID Year Title