Property Summary

NCBI Gene PubMed Count 40
Grant Count 109
R01 Count 82
Funding $15,471,401.35
PubMed Score 1847.20
PubTator Score 80.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.119 0.002
malignant mesothelioma -6.200 0.000
astrocytic glioma -2.200 0.010
posterior fossa group A ependymoma -2.600 0.000
psoriasis -2.500 0.000
oligodendroglioma -1.200 0.000
osteosarcoma -3.922 0.003
sonic hedgehog group medulloblastoma -3.400 0.000
atypical teratoid / rhabdoid tumor -4.700 0.000
glioblastoma -1.800 0.014
medulloblastoma, large-cell -3.700 0.000
Atopic dermatitis -1.100 0.006
lung cancer 5.400 0.000
colon cancer -2.300 0.000
interstitial cystitis 1.200 0.046
pilocytic astrocytoma 1.200 0.008
nasopharyngeal carcinoma -2.200 0.000
breast carcinoma -2.100 0.000
Pick disease -1.700 0.014
Breast cancer -4.200 0.000
ductal carcinoma in situ -2.200 0.001
invasive ductal carcinoma -3.000 0.000
pituitary cancer -1.500 0.010

Synonym

Accession O00533 B7ZL03 Q2M3G2 Q59FY0
Symbols CALL
L1CAM2

Gene

Gene RIF (24)

PMID Text
25943212 CHL1 expression patient-derived lymphoblasts correlated with clinical outcome in depressive disorder patients.
24971532 Our data collectively indicate that miR-182 in PTC promotes cell proliferation and invasion through direct suppression of CHL1, supporting the potential utility of miR-182 inhibition as a novel therapeutic strategy against PTC.
24512353 There was no statistical association between polymorphisms of the CHL1 gene and idiopathic scoliosis in a Chinese population.
24288179 our findings suggest that miR-590-5p acts as an oncogene by targeting the CHL1 gene and promotes cervical cancer proliferation
24203666 In 1 of 113 Colombian children with refractory epilepsy, MLPA showed a subtelomeric duplication of exon 3 of CHL1, also present in 2 relatives.
23906755 CHL1 has a role in human breast tumorigenesis and progression
23857787 The rs2272522 polymorphism (in the CHL1 gene) was found to exhibit a highly significant association with schizophrenia in the Qatari population.
22988240 BACE1(-/-) axon guidance defects are likely the result of abrogated BACE1 processing of CHL1 and BACE1 deficiency produces a CHL1 loss-of-function phenotype
22909203 The miRNA miR-151-3p had 6.7-fold higher basal expression in paroxetine-sensitive LCLs. This corresponds with lower expression of CHL1, a target of miR-151-3p
22744455 Overall, our study found a significant association of IL-17RC gene polymorphisms with AIS in a Chinese Han population, indicating IL-17RC gene may be as a susceptibility gene for AIS.
More...

AA Sequence

MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWT      1 - 70
KDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDP     71 - 140
LEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPR    141 - 210
LRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGD    211 - 280
LPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGIL    281 - 350
LCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVD    351 - 420
VRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAG    421 - 490
SYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFE    491 - 560
INGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRL    561 - 630
TWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQP    631 - 700
SDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTL    701 - 770
RVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHG    771 - 840
RLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQ    841 - 910
TPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHL    911 - 980
SNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPIEVFEPGAEHIVRLMTK    981 - 1050
NWGDNDSIFQDVIETRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLH   1051 - 1120
PDPEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGAYAGSKE   1121 - 1190
KGSVESNGSSTATFPLRA                                                       1191 - 1208
//

Text Mined References (42)

PMID Year Title
25943212 2015 CHL1, ITGB3 and SLC6A4 gene expression and antidepressant drug response: results from the Munich Antidepressant Response Signature (MARS) study.
24971532 2014 miR-182 targets CHL1 and controls tumor growth and invasion in papillary thyroid carcinoma.
24512353 2014 Lack of association between the CHL1 gene and adolescent idiopathic scoliosis susceptibility in Han Chinese: a case-control study.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24288179 2014 MicroRNA-590 promotes cervical cancer cell growth and invasion by targeting CHL1.
24203666 2013 [Detection of subtelomeric rearrangements due to MLPA in paediatric patients with refractory epilepsy in Colombia: the role of the CHL1 gene in pharmacoresistance].
23906755 2013 CHL1 is involved in human breast tumorigenesis and progression.
23857787 2013 Significant association of close homologue of L1 gene polymorphism rs2272522 with schizophrenia in Qatar.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...