Property Summary

NCBI Gene PubMed Count 24
PubMed Score 87.89
PubTator Score 77.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 1.3e-03
interstitial cystitis -4.100 2.3e-03

Gene RIF (7)

AA Sequence

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV      1 - 70
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR     71 - 140
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK                              141 - 184
//

Text Mined References (24)

PMID Year Title