Property Summary

NCBI Gene PubMed Count 23
Grant Count 92
R01 Count 37
Funding $15,672,715.95
PubMed Score 82.23
PubTator Score 77.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.100 0.001
interstitial cystitis -4.900 0.000

Synonym

Accession O00526 B0YJ92 O00457 Q53YV0 UP2
Symbols UP2
UPII

Gene

Gene RIF (6)

PMID Text
25611245 UPII, GATA3, and p40, when used in combination, are highly sensitive in the differential diagnosis of invasive urothelial carcinoma.
25449628 UPII was highly specific/moderately sensitive for urothelial carcinoma. May be a potentially useful marker to identify urothelial lineage and help distinguish UC from prostate cancer or, in conjunction with GATA3, from metastatic breast cancer.
25389341 UPII demonstrates a significantly higher sensitivity than UPIII in conventional and variant urothelial carcinomas
24978921 Uroplakin II antibody BC21 demonstrated superior sensitivity and specificity in urothelial carcinoma, compared with uroplakin III, suggesting an advantage in differential diagnosis of urothelial carcinoma and in the detection of tumors of unknown origin.
18440837 combination of prostate stem cell antigen enhancer and uroplakin II promoter is feasible in constructing bladder cancer-specific vectors
17012268 study offers no definitive support for uroplakin II mutations causing human renal tract malformations

AA Sequence

MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV      1 - 70
VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR     71 - 140
RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK                              141 - 184
//

Text Mined References (23)

PMID Year Title
25611245 Uroplakin II (UPII), GATA3, and p40 are Highly Sensitive Markers for the Differential Diagnosis of Invasive Urothelial Carcinoma.
25449628 2015 Utility of uroplakin II expression as a marker of urothelial carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25389341 2014 Uroplakin II is a more sensitive immunohistochemical marker than uroplakin III in urothelial carcinoma and its variants.
24978921 2014 A newly developed uroplakin II antibody with increased sensitivity in urothelial carcinoma of the bladder.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440837 Prostate stem cell antigen enhancer and uroplakin II promoter based bladder cancer targeted tissue-specific vector.
17012268 2006 Mutation analyses of Uroplakin II in children with renal tract malformations.
More...