Property Summary

Ligand Count 900
NCBI Gene PubMed Count 136
PubMed Score 429.07
PubTator Score 479.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 7.2e-04
atypical teratoid/rhabdoid tumor -1.100 2.0e-04
ependymoma -1.300 1.8e-11
glioblastoma -1.100 9.4e-07
osteosarcoma -1.396 8.9e-05
ulcerative colitis -1.100 2.8e-05

Gene RIF (140)

AA Sequence

MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLD      1 - 70
SEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVS     71 - 140
LKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKS    141 - 210
SKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSV    211 - 280
GPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETK    281 - 350
QSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF    351 - 420
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGA    421 - 490
VSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEEL    491 - 560
CLRFMREVERLMTPEKQSS                                                       561 - 579
//

Text Mined References (139)

PMID Year Title