Property Summary

NCBI Gene PubMed Count 121
Grant Count 399
R01 Count 172
Funding $62,326,758.14
PubMed Score 400.21
PubTator Score 479.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.396 0.000
ependymoma -1.300 0.000
glioblastoma -1.100 0.000
pediatric high grade glioma -1.300 0.000
atypical teratoid/rhabdoid tumor -1.100 0.000
ulcerative colitis -1.100 0.000

Synonym

Accession O00519 D3DQ19 Q52M86 Q5TDF8
Symbols PSAB
FAAH-1

Gene

PANTHER Protein Class (1)

Gene RIF (125)

PMID Text
26808012 FAAH gene variation was shown to associate with cold pain sensitivity with P129T/rs324420 being the most likely causal variant as it is known to reduce the FAAH enzyme activity.
26806592 Data suggest that subjects who are carriers of minor allele (A) at missense mutation rs324420 in FAAH benefit from increased consumption of oleic and docosahexaenoic acids in dietary treatment of abdominal obesity.
26561012 the FAAH 385C>A polymorphism may have a role in the endocannabinoid-related obesity phenotype
26111155 Studied the mechanism of FAAH for lipid selection to specifically hydrolyze anandamide, examining the role of the dynamic paddle formed at the boundaries of the FAAH catalytic site.
26106535 Cannabis-using FAAH C/C carriers and A carrying controls have reduced white matter integrity compared to control C/C carriers.
26036940 evidence that the genetic variant rs324420 in FAAH is associated with measurable differences in brain FAAH binding as per PET [(11)C]CURB measurement.
25731744 FAAH genetic variation enhances fronto-amygdala function regarding fear regulation in mouse and human.
25558980 Specific FAAH polymorphisms are associated with refractory postoperative nausea and vomiting , opioid-related respiratory depression, and prolonged PACU stay due to opioid adverse effects in white children undergoing tonsillectomy.
25456842 fatty acid amide hydrolase activity decreases in the frontal cortex from patients with Alzheimer's disease
25444073 no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivity
More...

AA Sequence

MVQYELWAALPGASGVALACCFVAAAVALRWSGRRTARGAVVRARQRQRAGLENMDRAAQRFRLQNPDLD      1 - 70
SEALLALPLPQLVQKLHSRELAPEAVLFTYVGKAWEVNKGTNCVTSYLADCETQLSQAPRQGLLYGVPVS     71 - 140
LKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKS    141 - 210
SKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSV    211 - 280
GPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYETDNYTMPSPAMRRAVLETK    281 - 350
QSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQNFKGDFVDPCLGDLVSILKLPQWLKGLLAF    351 - 420
LVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAPALDLNAPGRATGA    421 - 490
VSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEEL    491 - 560
CLRFMREVERLMTPEKQSS                                                       561 - 579
//

Text Mined References (124)

PMID Year Title
26808012 2016 Effect of endocannabinoid degradation on pain: role of FAAH polymorphisms in experimental and postoperative pain in women treated for breast cancer.
26806592 2016 Interactions between dietary oil treatments and genetic variants modulate fatty acid ethanolamides in plasma and body weight composition.
26561012 2015 Circulating Endocannabinoids and the Polymorphism 385C>A in Fatty Acid Amide Hydrolase (FAAH) Gene May Identify the Obesity Phenotype Related to Cardiometabolic Risk: A Study Conducted in a Brazilian Population of Complex Interethnic Admixture.
26111155 2015 Keys to Lipid Selection in Fatty Acid Amide Hydrolase Catalysis: Structural Flexibility, Gating Residues and Multiple Binding Pockets.
26106535 2015 Poorer frontolimbic white matter integrity is associated with chronic cannabis use, FAAH genotype, and increased depressive and apathy symptoms in adolescents and young adults.
26036940 2015 The fatty acid amide hydrolase C385A variant affects brain binding of the positron emission tomography tracer [11C]CURB.
25731744 2015 FAAH genetic variation enhances fronto-amygdala function in mouse and human.
25558980 2015 Novel associations between FAAH genetic variants and postoperative central opioid-related adverse effects.
25456842 2014 Normal aging in rats and pathological aging in human Alzheimer's disease decrease FAAH activity: modulation by cannabinoid agonists.
25444073 2014 Increased placental expression of cannabinoid receptor 1 in preeclampsia: an observational study.
More...