Property Summary

NCBI Gene PubMed Count 13
PubMed Score 285.04
PubTator Score 88.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.15106453529573E-17
lung adenocarcinoma 2714 9.98874651763556E-14
ovarian cancer 8492 7.62380654409438E-9
pancreatic cancer 2300 1.40781925592721E-5
osteosarcoma 7933 3.1114814262461E-5
psoriasis 6685 9.69269816807499E-5
interstitial cystitis 2299 1.22474404547824E-4
medulloblastoma, large-cell 6234 5.19789521200322E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.26447350658025E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.67050564252079E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00577528907851978
ductal carcinoma in situ 1745 0.00614316046563804
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0427815509854025
invasive ductal carcinoma 2950 0.0432502083311464

Expression

Synonym

Accession O00515 O95614 Q96GD8 Lad-1
Symbols LadA

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Gene RIF (2)

PMID Text
25605789 Here, we focus on the trSNP in LAD1, a gene that encodes for Ladinin-1, a collagenous anchoring filament protein of basement membrane that is responsible for maintaining cohesion at the dermal-epidermal junction.
20830310 Calcium regulation of EGF-induced ERK5 activation is mediated through interaction of MEKK2 with the adaptor protein Lad1.

AA Sequence

MAVSRKDWSALSSLARQRTLEDEEEQERERRRRHRNLSSTTDDEAPRLSQNGDRQASASERLPSVEEAEV      1 - 70
PKPLPPASKDEDEDIQSILRTRQERRQRRQVVEAAQAPIQERLEAEEGRNSLSPVQATQKPLVSKKELEI     71 - 140
PPRRRLSREQRGPWALEEESLVGREPEERKKGVPEKSPVLEKSSMPKKTAPEKSLVSDKTSISEKVLASE    141 - 210
KTSLSEKIAVSEKRNSSEKKSVLEKTSVSEKSLAPGMALGSGRRLVSEKASIFEKALASEKSPTADAKPA    211 - 280
PKRATASEQPLAQEPPASGGSPATTKEQRGRALPGKNLPSLAKQGASDPPTVASRLPPVTLQVKIPSKEE    281 - 350
EADMSSPTQRTYSSSLKRSSPRTISFRMKPKKENSETTLTRSASMKLPDNTVKLGEKLERYHTAIRRSES    351 - 420
VKSRGLPCTELFVAPVGVASKRHLFEKELAGQSRAEPASSRKENLRLSGVVTSRLNLWISRTQESGDQDP    421 - 490
QEAQKASSATERTQWGQKSDSSLDAEV                                               491 - 517
//

Text Mined References (19)

PMID Year Title
25605789 2015 Long-Term Balancing Selection in LAD1 Maintains a Missense Trans-Species Polymorphism in Humans, Chimpanzees, and Bonobos.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20830310 2010 Calcium regulation of EGF-induced ERK5 activation: role of Lad1-MEKK2 interaction.
18570454 2008 Proteomic analysis of exosomes from human neural stem cells by flow field-flow fractionation and nanoflow liquid chromatography-tandem mass spectrometry.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16083285 Global phosphoproteome of HT-29 human colon adenocarcinoma cells.
More...