Property Summary

NCBI Gene PubMed Count 22
PubMed Score 30.51
PubTator Score 37.56

Knowledge Summary


No data available



Accession O00507 O14601
Symbols DFFRY


  Ortholog (1)

Species Source
Fruitfly OMA Inparanoid

Gene RIF (9)

26008593 This is the first research investigating the utility of TTTY15-USP9Y in prostate cancer detection
23650841 An impact of the identified polymorphism on discrimination of alleles of the M46 locus with various techniques was discussed, and solutions ensuring correctness of the genotyping results were proposed.
18511697 Observational study of gene-disease association. (HuGE Navigator)
18357961 Frequency of AZF microdeletions in peripheral leukocytes and testicular cells in Chinese men with idiopathic infertility.
18205040 rare Y chromosome missense mutation in exon 25 of human USP9Y revealed by pyrosequencing
15696490 Findings indicated that AZF microdeletion and chromosomal abnormality should be important causes of male infertility.
12925892 Selection is acting to maintain the amino acid sequence of both the X and the Y-linked genes.
12895410 results suggest that, through de-ubiquitination, ubiquitin specific protease 9(USP9Y) may stabilize a specific target protein that is important for male germ cell development
11869379 detection of mrna in azooermic men

AA Sequence

GPAAHHLNNPQKTGQRTQENYEGNEEVSSPQMKDQ                                      2521 - 2555

Text Mined References (23)

PMID Year Title
26162009 2015 Isoform-Level Gene Expression Profiles of Human Y Chromosome Azoospermia Factor Genes and Their X Chromosome Paralogs in the Testicular Tissue of Non-Obstructive Azoospermia Patients.
26008593 2015 Clinical utility of a novel urine-based gene fusion TTTY15-USP9Y in predicting prostate biopsy outcome.
23650841 [Identification of a novel Y-SNP in the USP9Y gene and its impact on genotyping alleles of the M46 locus].
19246359 2009 Spermatogenesis in a man with complete deletion of USP9Y.
18511697 2008 Genetic variants of Y chromosome are associated with a protective lipid profile in black men.
18357961 AZF gene expression analysis in peripheral leukocytes and testicular cells from idiopathic infertility.
18205040 2008 A rare Y chromosome missense mutation in exon 25 of human USP9Y revealed by pyrosequencing.
16893908 2006 Natural transmission of USP9Y gene mutations: a new perspective on the role of AZFa genes in male fertility.
15696490 2005 [A genetic study on microdeletion of azoospermia factor region on Y chromosome of azoospermia and oligozoospermia patients].
14983005 2004 Protein structure prediction for the male-specific region of the human Y chromosome.