Property Summary

NCBI Gene PubMed Count 34
Grant Count 18
R01 Count 15
Funding $860,537.76
PubMed Score 19.94
PubTator Score 17.18

Knowledge Summary

Patent (3,124)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 0.004
ovarian cancer 1.700 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (11)

PMID Text
26553096 STK25 regulates lipid partitioning in human liver cells by controlling TAG synthesis as well as lipolytic activity and thereby NEFA release from lipid droplets for beta-oxidation and TAG secretion.
25550858 Our results suggest that MST4, STK25 and PDCD10 are upregulated in prostate cancer and may play roles in prostate tumorigenesis.
23889253 This review notes that all 3 human germinal center kinase III genes consist of 12 exons and are ubiquitously expressed. In SOK1 and MST4, exon 1 encodes a 5' untranslated region, but this is not the case for MST3.
22782892 Down-modulation of STK25, but not STK24, rescued medulloblastoma cells from NGF-induced TrkA-dependent cell death, suggesting that STK25 is part of the death-signaling pathway initiated by TrkA and CCM2.
22652780 PDCD10 might be a regulatory adaptor required for STK25 functions, which differ distinctly depending on the redox status of the cells that may be potentially related to tumor progression.
22391949 Significantly higher STK25 levels were observed in the skeletal muscle of type 2 diabetic patients, compared with individuals with normal glucose tolerance.
21396913 The results of the study results indicate that attenuation of SOK1 enhanced cell migration and lead to changes in the expression of migration-associated proteins such as FAK and GM130.
20592472 In cultured human endothelial cells, CCM3 and STK25 regulated barrier function in a manner similar to CCM2, and STKs negatively regulated Rho by directly activating moesin.
18364353 SOK1 entry into the nucleus is important for the cell death response
17253963 Ste20 family member (MAP4K3) that is required for maximal S6K (S6 kinase)/4E-BP1 [eIF4E (eukaryotic initiation factor 4E) that is required for maximal S6K (S6 kinase).
More...

AA Sequence

MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVL      1 - 70
SQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRD     71 - 140
IKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAK    141 - 210
GEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFL    211 - 280
TELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVK    281 - 350
RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN    351 - 420
HLTSTR                                                                    421 - 426
//

Text Mined References (35)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26553096 2016 Protein kinase STK25 controls lipid partitioning in hepatocytes and correlates with liver fat content in humans.
25550858 2014 Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23889253 2013 SOcK, MiSTs, MASK and STicKs: the GCKIII (germinal centre kinase III) kinases and their heterologous protein-protein interactions.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22782892 2012 STK25 protein mediates TrkA and CCM2 protein-dependent death in pediatric tumor cells of neural origin.
More...