Property Summary

Ligand Count 2
NCBI Gene PubMed Count 35
PubMed Score 21.86
PubTator Score 17.18

Knowledge Summary

Patent (3,124)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 3.7e-03
ovarian cancer 1.700 1.4e-06

Gene RIF (11)

AA Sequence

MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVL      1 - 70
SQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRD     71 - 140
IKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAK    141 - 210
GEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFL    211 - 280
TELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVK    281 - 350
RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN    351 - 420
HLTSTR                                                                    421 - 426
//

Text Mined References (36)

PMID Year Title