Property Summary

NCBI Gene PubMed Count 85
Grant Count 58
R01 Count 37
Funding $5,715,182.14
PubMed Score 313.33
PubTator Score 181.44

Knowledge Summary

Patent

No data available

Expression

Gene RIF (76)

PMID Text
27010153 The levels of ESM1, CLDN5, IL-1beta, IL-6, and TNF-alpha were significantly higher in the migraine attack group than in the control group
26654362 analysis of the membrane driven cis interactions of claudin-5 proteins in the formation of the blood brain barrier tight junctions
26464708 the expression of claudin-5 and claudin-9 was down-regulated while the expression of claudin-8 was up-regulated in cervical carcinoma tissues compared with adjacent non-neoplastic tissues.
26409663 Plasma CLDN5 levels decreased in patients with stable asthma compared with those in control subjects, suggesting that asthma therapy can decrease plasma CLDN5 levels
25973092 the relationship between vWF and claudin-5, which are indicators of endothelial cell dysfunction and tight junction activity, may be a predictor of disease activity in rheumatoid arthritis.
25667483 An association between strong claudin-5 expression and higher serum levels of TATI (p=0.04) and CA125 (p=0.008) were found
25452107 miR-18a and RUNX1 could reversely regulate the permeability of blood-tumor barrier as well as the expressions and distributions of ZO-1, occludin and claudin-5.
25440958 These data support that loss of claudin-5 in cardiomyocytes and endothelial cells is prevalent in human heart failure
25345514 The findings suggest that down regulated CLDN1 and CLDN5 genes have potential relevance in relation to the progression of glioblastoma multiforme.
25342221 Data show that C-terminal domain of Clostridium perfringens enterotoxin (cCPE)-binding to claudin 1 and claudin 5 is prevented by two residues in extracellular loop 2 of Cld1 (Asn(150) and Thr(153)) and Cld5 (Asp(149) and Thr(151)).
More...

AA Sequence

MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSV      1 - 70
LALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFA     71 - 140
NIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATG    141 - 210
DYDKKNYV                                                                  211 - 218
//

Text Mined References (86)

PMID Year Title
27010153 2016 Serum levels of endocan, claudin-5 and cytokines in migraine.
26654362 2016 Molecular Architecture of the Blood Brain Barrier Tight Junction Proteins--A Synergistic Computational and In Vitro Approach.
26464708 2015 Expression of claudin-5, -7, -8 and -9 in cervical carcinoma tissues and adjacent non-neoplastic tissues.
26409663 2015 Claudin 5 in a murine model of allergic asthma: Its implication and response to steroid treatment.
25973092 2015 Roles of claudin-5 and von Willebrand factor in patients with rheumatoid arthritis.
25816133 2015 Tumor necrosis factor disrupts claudin-5 endothelial tight junction barriers in two distinct NF-?B-dependent phases.
25667483 2015 Claudin-5 is associated with elevated TATI and CA125 levels in mucinous ovarian borderline tumors.
25452107 2015 MiR-18a increased the permeability of BTB via RUNX1 mediated down-regulation of ZO-1, occludin and claudin-5.
25440958 Claudin-5 levels are reduced from multiple cell types in human failing hearts and are associated with mislocalization of ephrin-B1.
25345514 2014 Down regulated expression of Claudin-1 and Claudin-5 and up regulation of ?-catenin: association with human glioma progression.
More...