Property Summary

NCBI Gene PubMed Count 89
PubMed Score 349.39
PubTator Score 181.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
breast carcinoma -2.700 9.0e-06
dermatomyositis 1.400 1.9e-03
ductal carcinoma in situ -2.100 1.8e-05
fibroadenoma -2.100 5.4e-03
interstitial cystitis 1.200 1.6e-03
intraductal papillary-mucinous adenoma (... -1.500 6.3e-06
intraductal papillary-mucinous carcinoma... -1.400 1.9e-04
intraductal papillary-mucinous neoplasm ... -1.700 1.9e-04
invasive ductal carcinoma -2.600 4.2e-05
lung adenocarcinoma -3.800 4.1e-19
medulloblastoma, large-cell -1.500 4.4e-05
non-inflammatory breast cancer -2.200 3.6e-03
non-small cell lung cancer -2.203 9.2e-23
psoriasis -1.400 2.6e-08

Gene RIF (77)

AA Sequence

MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSV      1 - 70
LALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFA     71 - 140
NIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATG    141 - 210
DYDKKNYV                                                                  211 - 218
//

Text Mined References (90)

PMID Year Title