Property Summary

NCBI Gene PubMed Count 142
Grant Count 71
R01 Count 48
Funding $5,510,527.03
PubMed Score 214.65
PubTator Score 163.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 0.023
psoriasis -1.800 0.000
posterior fossa group B ependymoma -1.200 0.000
group 3 medulloblastoma -2.300 0.000
atypical teratoid/rhabdoid tumor -2.800 0.000
glioblastoma -1.100 0.004
adrenocortical carcinoma -1.104 0.027
fibroadenoma -1.300 0.002
adult high grade glioma -1.300 0.002
aldosterone-producing adenoma -1.116 0.005
spina bifida 1.153 0.045
ductal carcinoma in situ -1.600 0.001
invasive ductal carcinoma -2.000 0.001
ovarian cancer 1.400 0.000

Gene

PDB

1MV0   1MUZ   1MV3   2FIC   2RMY   2RND   5I22  

Gene RIF (87)

PMID Text
26833786 Data demonstrate that EHBP1L1 links Rab8 and the Bin1-dynamin complex, which generates membrane curvature and excises the vesicle at the endocytic recycling compartment for apical transport.
26738348 The frequencies of BIN1 alleles were similar in both control and Alzheimer patients showing o no association.
26733302 no association was found for either polymorphism, suggesting that these genes are not implicated in the aetiology of Alzheimer's disease in all populations.
26233692 Alterations in the BIN1 locus, previously associated with Alzheimer disease, may modify the age of onset of GBA-associated Parkinson.
26195312 In vitro studies in human Caco-2 cells showed that Bin1 antibody altered the expression of tight junction proteins and improved barrier function.
25957634 This study demonistrated that BIN1 mutation releated to Centronuclear myopathy.
25683635 Results show low expression of Bin1, along with high expression of IDO, are predictor for poor prognosis in esophageal squamous cell cancer and thereby could be used to establish new therapeutic strategies.
25630570 This study findings demonstrate that rs744373 itself or a variation in linkage disequilibrium may provide a neurogenetic mechanism for BIN.1
25578476 Reduced BIN1 expression is associated with cutaneous T-cell lymphoma.
25487648 BIN1/M-Amphiphysin2 has a role in inducing clustering of phosphoinositides to recruit its downstream partner dynamin
More...

AA Sequence

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLA      1 - 70
SVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRI     71 - 140
AKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELI    141 - 210
KAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT    211 - 280
VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPS    281 - 350
KEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLW    351 - 420
EPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSL    421 - 490
PAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDE    491 - 560
GWLMGVKESDWNQHKELEKCRGVFPENFTERVP                                         561 - 593
//

Text Mined References (152)

PMID Year Title
26833786 2016 EHBP1L1 coordinates Rab8 and Bin1 to regulate apical-directed transport in polarized epithelial cells.
26738348 2015 Potential genetic biomarkers in the early diagnosis of Alzheimer disease: APOE and BIN1.
26733302 2016 Association study of the BIN1 and IL-6 genes on Alzheimer's disease.
26506308 2015 Amphiphysin 2 Orchestrates Nucleus Positioning and Shape by Linking the Nuclear Envelope to the Actin and Microtubule Cytoskeleton.
26233692 2015 The Alzheimer disease BIN1 locus as a modifier of GBA-associated Parkinson disease.
26195312 2016 Novel Colitis Immunotherapy Targets Bin1 and Improves Colon Cell Barrier Function.
25957634 2015 Centronuclear myopathies: genotype-phenotype correlation and frequency of defined genetic forms in an Italian cohort.
25683635 2015 Low expression of Bin1, along with high expression of IDO in tumor tissue and draining lymph nodes, are predictors of poor prognosis for esophageal squamous cell cancer patients.
25630570 2015 Bridging Integrator 1 (BIN1) Genotype Effects on Working Memory, Hippocampal Volume, and Functional Connectivity in Young Healthy Individuals.
25578476 2015 BIN1 tumor suppressor regulates Fas/Fas ligand-mediated apoptosis through c-FLIP in cutaneous T-cell lymphoma.
More...