Property Summary

NCBI Gene PubMed Count 155
PubMed Score 223.27
PubTator Score 163.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Myopathies, Structural, Congenital 15 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Alzheimer's disease 658 4.897 2.4
Disease Target Count Z-score Confidence
Centronuclear myopathy 27 5.949 3.0

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.089 2.2e-02
adult high grade glioma -1.300 2.2e-03
aldosterone-producing adenoma -1.116 4.7e-03
atypical teratoid / rhabdoid tumor -2.300 7.4e-10
ductal carcinoma in situ -1.600 7.4e-04
ependymoma -1.100 3.4e-08
esophageal adenocarcinoma 1.100 2.3e-02
fibroadenoma -1.300 1.8e-03
glioblastoma -1.100 4.0e-03
group 3 medulloblastoma -2.100 8.4e-05
invasive ductal carcinoma -2.000 1.0e-03
ovarian cancer 1.400 1.7e-04
psoriasis -1.500 5.1e-04
spina bifida 1.153 4.5e-02

 IMPC Phenotype (1)

Gene RIF (100)

AA Sequence

MAEMGSKGVTAGKIASNVQKKLTRAQEKVLQKLGKADETKDEQFEQCVQNFNKQLTEGTRLQKDLRTYLA      1 - 70
SVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRI     71 - 140
AKRGRKLVDYDSARHHYESLQTAKKKDEAKIAKPVSLLEKAAPQWCQGKLQAHLVAQTNLLRNQAEEELI    141 - 210
KAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT    211 - 280
VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPS    281 - 350
KEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLW    351 - 420
EPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSL    421 - 490
PAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDE    491 - 560
GWLMGVKESDWNQHKELEKCRGVFPENFTERVP                                         561 - 593
//

Text Mined References (165)

PMID Year Title