Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.00
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 0.008
colon cancer 1.300 0.001
lung adenocarcinoma 1.300 0.000
ovarian cancer 1.300 0.000

Synonym

Accession O00488 B2R4S0 Q5T2H7
Symbols ZT86

Gene

PANTHER Protein Class (1)

PDB

1ZR9  

Gene RIF (1)

PMID Text
18287285 The tertiary structure of the zinc finger domain of ZNF593 is composed of a beta-hairpin that positions the cysteine side chains for zinc coordination, followed by an atypical kinked alpha-helix containing the two histidine side chain ligands.

AA Sequence

MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAEFDPDLPGGGLHRCLACARYF      1 - 70
IDSTNLKTHFRSKDHKKRLKQLSVEPYSQEEAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST           71 - 134
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23045392 2012 The conserved Bud20 zinc finger protein is a new component of the ribosomal 60S subunit export machinery.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18287285 2008 The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...