Property Summary

NCBI Gene PubMed Count 28
Grant Count 12
R01 Count 6
Funding $1,087,092.5
PubMed Score 55.67
PubTator Score 38.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.230 0.040
Multiple myeloma 1.411 0.012
intraductal papillary-mucinous neoplasm ... 1.300 0.018
lung cancer 2.500 0.000
Breast cancer 3.100 0.025
group 3 medulloblastoma 1.500 0.000
invasive ductal carcinoma 1.200 0.003
ovarian cancer 2.400 0.000

 GWAS Trait (1)

Gene RIF (7)

PMID Text
26510456 Deubiquitylase POH1 stabilizes E2F1 protein through binding to and deubiquitylating E2F1 in liver cancer.
22909820 The data demonstrated that proteasomal POH1 is a key de-ubiquitinating enzyme that regulates ubiquitin conjugates generated in response to damage and that several aspects of the DNA double-strand break response are regulated by the proteasome.
19732767 Down-regulation of PSMD14 results in decreased cell proliferation, cell cycle arrest and senescence. A comparative study with PSMB5, revealed that PSMB5 and PSMD14 have different effects on cell cycle, senescence and associated molecular events.
19419512 Disorder of POH1 expression is involved in the onset of idiopathic nephrotic syndrome (INS), and confers multidrug resistance in children with INS
19214193 Specificity for K63-linked polyubiquitin is a common property of the JAMM/MPN+ family of deubiquitinating enzymes.
17237285 An intact zinc metalloproteinase motif of Poh1 is essential for cell viability and 26S proteasome function.
16569633 Ectopic expression of POH1 in HEK293 cells decreased the level of c-Jun ubiquitination, leading to significant accumulation of the protein and a corresponding increase in AP1-mediated gene expression

AA Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI      1 - 70
DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA     71 - 140
VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN    141 - 210
ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP    211 - 280
KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK                                            281 - 310
//

Text Mined References (34)

PMID Year Title
26510456 2015 POH1 deubiquitylates and stabilizes E2F1 to promote tumour formation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909820 2012 The proteasomal de-ubiquitinating enzyme POH1 promotes the double-strand DNA break response.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
More...