Property Summary

NCBI Gene PubMed Count 28
PubMed Score 64.20
PubTator Score 38.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 3.100 2.5e-02
group 3 medulloblastoma 1.500 3.7e-04
intraductal papillary-mucinous neoplasm ... 1.300 1.8e-02
invasive ductal carcinoma 1.200 2.5e-03
lung cancer 2.500 1.6e-05
Multiple myeloma 1.411 1.2e-02
ovarian cancer 2.400 4.6e-05
Waldenstrons macroglobulinemia 1.230 4.0e-02

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVI      1 - 70
DVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERA     71 - 140
VAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN    141 - 210
ELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDP    211 - 280
KRHLEEHVDVLMTSNIVQCLAAMLDTVVFK                                            281 - 310
//

Text Mined References (37)

PMID Year Title