Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $421,416
PubMed Score 12.12
PubTator Score 10.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.354 0.005
Multiple myeloma 2.038 0.000
astrocytoma -1.500 0.003
pancreatic ductal adenocarcinoma liver m... -1.112 0.047
ovarian cancer -1.300 0.000

Synonym

Accession O00483 A4D109 Q6FHN5
Symbols MLRQ
CI-9k
CI-MLRQ

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
23746447 Findings support reassignment of the NDUFA4 protein to complex IV and suggest that patients with unexplained COX deficiency should be screened for NDUFA4 mutations.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD      1 - 70
YSKLKKERPDF                                                                71 - 81
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23746447 2013 NDUFA4 mutations underlie dysfunction of a cytochrome c oxidase subunit linked to human neurological disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902835 2012 NDUFA4 is a subunit of complex IV of the mammalian electron transport chain.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...