Property Summary

NCBI Gene PubMed Count 116
Grant Count 159
R01 Count 107
Funding $20,149,101.06
PubMed Score 304.61
PubTator Score 230.02

Knowledge Summary

Patent (18,143)

Expression

Synonym

Accession O00482 B4E2P3 O95642 Q147U3
Symbols B1F
CPF
FTF
B1F2
LRH1
LRH-1
FTZ-F1
hB1F-2
FTZ-F1beta

Gene

PDB

4RWV   3TX7   1YOK   1YUC   1ZDU   2A66   3PLZ   4DOR   4DOS   4IS8   4ONI   4PLD   4PLE  

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (11)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
485348 other 19 / 0 / 41 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): Luminescence-based primary assay to identify LRH1 inhibitors (3X%INH)
488769 other 2 / 0 / 0 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): fluorescence-based cell-based quantitative PCR assay to identify inhibitors of LRH-1 target gene expression
488781 summary 0 / 0 / 0 Summary of the probe development efforts to identify novel inverse agonists of the liver receptor homolog-1 (LRH1; NR5A2)
488782 confirmatory 13 / 0 / 3 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH1; NR5A2): Luminescence-based dose response assay to identify LRH1 inhibitors (Cyp19 aromatase-luciferase reporter)
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
602396 screening 460 / 0 / 363671 Luminescence-based cell-based primary high throughput screening assay to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2)
602418 summary 0 / 0 / 0 Summary of the probe development efforts to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2)
651613 screening 1949 / 0 / 393 Luminescence-based cell-based high throughput confirmation assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2)
651970 confirmatory 86 / 0 / 153 Luminescence-based cell-based high throughput dose response assay for inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2)
More...

Gene RIF (87)

PMID Text
26677080 The present study indicates that miR-381 may be a novel tumor suppressor that blocks HCC growth and invasion by targeting LRH-1.
26592175 The SNPs rs3790843 and rs3790844 in the NR5A2 gene are associated with pancreatic cancer risk in Japanese subjects.
26553876 Data suggest LRH1/NR5A2 exhibits phospholipid-mediated allosteric control of protein-protein binding interface in interactions with TIF2 (co-activator; transcription intermediary factor 2) and SHP (co-repressor; small heterodimer partner protein).
26421305 These findings show that POD-1/TCF21 regulates SF-1 and LRH-1 by distinct mechanisms, contributing to the understanding of POD-1 involvement and its mechanisms of action in adrenal and liver tumorigenesis.
26400164 LRH-1 drives colon cancer cell growth by repressing the expression of the CDKN1A gene in a p53-dependent manner.
26398198 SERBP1 is a component of the LRH-1 transcriptional complex.
26320367 Down-regulation of MicroRNA-381 promotes cell proliferation and invasion in colon cancer cells through up-regulation of LRH-1.
26241668 in spermatozoa the LRH-1 effects are closely integrated with the estrogen signaling, supporting LRH-1 as a downstream effector of the estradiol pathway on some sperm functions.
26241054 these data demonstrate that copper-mediated nuclear receptor dysfunction disrupts liver function in WD and potentially in other disorders associated with increased hepatic copper levels.
25987835 our findings present supportive evidence that ApoM is a regulator of human LRH-1 transcription, and further reveal the importance of ApoM as a critical regulator of bile acids metabolism
More...

AA Sequence

MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQGQMPENMQVSQ      1 - 70
FKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPY     71 - 140
CRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTIS    141 - 210
SAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSS    211 - 280
PESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMAD    281 - 350
QTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA    351 - 420
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYP    421 - 490
QQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA                       491 - 541
//

Text Mined References (119)

PMID Year Title
27298334 2016 LRH-1-dependent programming of mitochondrial glutamine processing drives liver cancer.
26761123 2016 Polymorphisms in NR5A2, gene encoding liver receptor homolog-1 are associated with preterm birth.
26677080 2016 MicroRNA-381 suppresses cell growth and invasion by targeting the liver receptor homolog-1 in hepatocellular carcinoma.
26653140 2015 A gene-expression screen identifies a non-toxic sumoylation inhibitor that mimics SUMO-less human LRH-1 in liver.
26592175 2015 Genome-wide association study-identified SNPs (rs3790844, rs3790843) in the NR5A2 gene and risk of pancreatic cancer in Japanese.
26553876 2016 Unexpected Allosteric Network Contributes to LRH-1 Co-regulator Selectivity.
26421305 2015 POD-1/TCF21 Reduces SHP Expression, Affecting LRH-1 Regulation and Cell Cycle Balance in Adrenocortical and Hepatocarcinoma Tumor Cells.
26400164 2016 LRH-1 drives colon cancer cell growth by repressing the expression of the CDKN1A gene in a p53-dependent manner.
26398198 2015 SERBP1 Is a Component of the Liver Receptor Homologue-1 Transcriptional Complex.
26320367 2015 Down-regulation of MicroRNA-381 promotes cell proliferation and invasion in colon cancer through up-regulation of LRH-1.
More...