Property Summary

NCBI Gene PubMed Count 22
Grant Count 1
R01 Count 1
Funding $129,810.67
PubMed Score 12.86
PubTator Score 18.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.001
osteosarcoma -1.444 0.000
lung cancer -2.500 0.003
active Crohn's disease 1.474 0.005
active ulcerative colitis 1.121 0.006
pilocytic astrocytoma 1.500 0.000
primary Sjogren syndrome 1.100 0.011
lung carcinoma -1.500 0.000
ovarian cancer 1.400 0.000

Synonym

Accession O00481 A2A278 A8K2C8 B4DIQ1 B4DRM2 E9PGB4 E9PHG8 Q0P515 Q147X5 Q53F15 Q99420 Q9HCY1
Symbols BTF5
BT3.1
CD277
BTN3.1

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

4F80   4F9L   4F9P   4JKW   4K55   4N7I   4N7U   4V1P  

Gene RIF (11)

PMID Text
26475929 These findings support intracellular sensing of prenyl pyrophosphates by BTN3A1 rather than extracellular presentation.
25637025 Human gamma-delta T cells are activated by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25065532 Ligand binding to the BTN3A1 B30.2 domain affects residues in the juxtamembrane region, suggesting ligand-induced conformational change.
24890657 evidence that gene(s) on Chr6 in addition to BTN3A1 are mandatory for PAg-mediated activation of Vgamma9Vdelta2 T cells.
24703779 These studies demonstrate that internal sensing of changes in pAg metabolite concentrations by BTN3A1 molecules is a critical step in Vgamma9Vdelta2 T cell detection of infection and tumorigenesis.
23872678 BTN3A1 represents an antigen-presenting molecule required for the activation of Vgamma9Vdelta2 T cells.
22846996 BTN3A1 is necessary for Vgamma9Vdelta2 activation and begin to unravel the extracellular events that occur during stimulation through the Vgamma9Vdelta2 T cell receptor.
22767497 investigation of role of CD277 in activation/inactivation of T-lymphocytes: Data indicate that modulation of CD277 interaction (with agonists or blocking antibodies) with T-cell antigen receptor can modulate activation/inactivation of T-lymphocytes.
21918970 CD277 triggering is not involved in CD16- or NKp46-induced NK cell activation.
21113407 Results point to a role for CD277 up-regulated by microenvironmental signals in the acquisition of a regulatory phenotype by ovarian tumor-associated myeloid cells.
More...

AA Sequence

MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ    211 - 280
FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN    281 - 350
PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG    351 - 420
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF    421 - 490
SEALYPVFRILTLEPTALTICPA                                                   491 - 513
//

Text Mined References (24)

PMID Year Title
26475929 2015 Sensor Function for Butyrophilin 3A1 in Prenyl Pyrophosphate Stimulation of Human V?2V?2 T Cells.
25637025 2015 Activation of human ?? T cells by cytosolic interactions of BTN3A1 with soluble phosphoantigens and the cytoskeletal adaptor periplakin.
25065532 2014 Synthesis of a phosphoantigen prodrug that potently activates V?9V?2 T-lymphocytes.
24890657 2014 V?9V?2 TCR-activation by phosphorylated antigens requires butyrophilin 3 A1 (BTN3A1) and additional genes on human chromosome 6.
24703779 2014 The intracellular B30.2 domain of butyrophilin 3A1 binds phosphoantigens to mediate activation of human V?9V?2 T cells.
23872678 2013 Butyrophilin 3A1 binds phosphorylated antigens and stimulates human ?? T cells.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
More...