Property Summary

NCBI Gene PubMed Count 24
PubMed Score 21.48
PubTator Score 18.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.474 5.2e-03
active ulcerative colitis 1.121 6.4e-03
Astrocytoma, Pilocytic 1.500 1.6e-07
cutaneous lupus erythematosus 1.200 8.4e-03
lung cancer -2.500 3.1e-03
lung carcinoma -1.500 6.4e-18
osteosarcoma -1.444 8.5e-05
ovarian cancer -1.100 2.8e-04
primary Sjogren syndrome 1.100 1.1e-02

Gene RIF (13)

AA Sequence

MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQ    211 - 280
FRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTAN    281 - 350
PILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG    351 - 420
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSF    421 - 490
SEALYPVFRILTLEPTALTICPA                                                   491 - 513
//

Text Mined References (26)

PMID Year Title