Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.25
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.903 4.7e-03
active ulcerative colitis 1.476 7.6e-03
adult high grade glioma 1.100 7.9e-03
astrocytoma 1.400 5.9e-12
Astrocytoma, Pilocytic 2.300 6.8e-11
cutaneous lupus erythematosus 1.500 3.0e-04
ependymoma 1.200 4.3e-05
Gaucher disease type 3 -1.100 9.1e-03
glioblastoma 1.100 8.8e-03
interstitial cystitis 1.500 3.7e-03
juvenile dermatomyositis 1.490 1.2e-09
lung cancer -2.700 5.9e-05
lung carcinoma -2.000 1.3e-19
medulloblastoma, large-cell -1.500 4.2e-04
nasopharyngeal carcinoma 1.100 6.8e-03
nephrosclerosis 1.157 6.2e-04
non-small cell lung cancer -1.051 3.9e-08
oligodendroglioma 1.300 2.8e-08
osteosarcoma -1.454 2.7e-04
ovarian cancer -2.400 9.4e-08
pituitary cancer -1.100 7.6e-04
primary Sjogren syndrome 2.400 4.9e-07
psoriasis -1.200 2.2e-02

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIAL    211 - 280
SRETEREREMKEMGYAATEQEISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTAN    281 - 350
AILLVSEDQRSVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK    351 - 420
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDGSHIYTFPHAS    421 - 490
FSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGLANESGEPQAEVTSLLLPAHP    491 - 560
GAEVSPSATTNQNHKLQARTEALY                                                  561 - 584
//

Text Mined References (19)

PMID Year Title