Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.16
PubTator Score 3.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis 1.157 0.001
cutaneous lupus erythematosus 1.500 0.000
psoriasis -1.200 0.022
astrocytoma 1.400 0.000
glioblastoma multiforme 1.600 0.000
oligodendroglioma 1.300 0.000
osteosarcoma -2.123 0.000
posterior fossa group A ependymoma 1.800 0.000
medulloblastoma, large-cell -1.500 0.000
juvenile dermatomyositis 1.542 0.000
non-small cell lung cancer -1.051 0.000
lung cancer -2.700 0.000
active Crohn's disease 2.119 0.002
ulcerative colitis 2.100 0.000
interstitial cystitis 1.500 0.004
adult high grade glioma 1.100 0.008
pilocytic astrocytoma 2.500 0.000
primary Sjogren syndrome 2.400 0.000
nasopharyngeal carcinoma 1.100 0.007
lung carcinoma -2.000 0.000
ovarian cancer -2.500 0.000
Gaucher disease type 3 -1.100 0.009
pituitary cancer -1.200 0.001

Synonym

Accession O00478 B4DWI7 E9PCP5
Symbols BTF3
BTN3.3

Gene

PANTHER Protein Class (2)

PDB

4F8T  

Gene RIF (1)

PMID Text
25243493 This study identified that CGPs was found to significantly correlate with the differential expression and methylation of genes encoding butyrophilin, subfamily 3, member A3.

AA Sequence

MKMASSLAFLLLNFHVSLFLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIM    141 - 210
RGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPISLLLLAGASYFLWRQQKEKIAL    211 - 280
SRETEREREMKEMGYAATEQEISLREKLQEELKWRKIQYMARGEKSLAYHEWKMALFKPADVILDPDTAN    281 - 350
AILLVSEDQRSVQRAEEPRDLPDNPERFEWRYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSKNVERKK    351 - 420
GWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISFYNATDGSHIYTFPHAS    421 - 490
FSEPLYPVFRILTLEPTALTICPIPKEVESSPDPDLVPDHSLETPLTPGLANESGEPQAEVTSLLLPAHP    491 - 560
GAEVSPSATTNQNHKLQARTEALY                                                  561 - 584
//

Text Mined References (19)

PMID Year Title
25243493 2014 Correlation between DNA methylation and gene expression in the brains of patients with bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
20208008 2010 BTN1A1, the mammary gland butyrophilin, and BTN2A2 are both inhibitors of T cell activation.
19946888 2010 Defining the membrane proteome of NK cells.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...