Property Summary

NCBI Gene PubMed Count 21
PubMed Score 13.35
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.100 4.4e-04
medulloblastoma, large-cell 1.100 1.2e-04
nephrosclerosis -1.784 3.4e-02
pancreatic ductal adenocarcinoma liver m... -1.230 2.7e-03

Gene RIF (14)

AA Sequence

MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMNITMVAMVNST      1 - 70
SPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQERSRLCSIALSGMLLGCFTAI     71 - 140
LIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIK    141 - 210
AMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLL    211 - 280
TKKFRLITVRKIATILGSLPSSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSF    281 - 350
LMGASRGFSSIAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL    351 - 420
//

Text Mined References (24)

PMID Year Title