Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.18
PubTator Score 12.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
nephrosclerosis -1.784 0.034
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.230 0.003

Synonym

Accession O00476 B7WNJ5 B7Z511 Q8WWC7 Q9H533
Symbols NPT4
GOUT4
UAQTL4

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
21778665 hNPT4 (SLC17A3) mediated time- and concentration-dependent uptake of OTxA (K(m): 802.8 microM) in a pH- and voltage-sensitive manner.
21282933 variants carrying SNP V257F, G279R, or P378L exhibited reduced transport of para-aminohippurate, bumetanide, estrone and urate; SNPs may contribute to inter-individual differences in disposition of anionic drugs and certain endogenous organic anions
20810651 a model of urate secretion in the renal tubular cell, where intracellular urate taken up via OAT1 and/or OAT3 from the blood exits from the cell into the lumen via hNPT4.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20162743 SLC17A3 seems to have a major role in determination of serum uric acid repeated measurements variation.
20162743 Observational study of gene-disease association. (HuGE Navigator)
20053405 Genetic variants within SLC2A9,ABCG2 and SLC17A3 are associated with uric acid levels
20053405 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19890391 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MATKTELSPTARESKNAQDMQVDETLIPRKVPSLCSARYGIALVLHFCNFTTIAQNVIMNITMVAMVNST      1 - 70
SPQSQLNDSSEVLPVDSFGGLSKAPKSLPAKSSILGGQFAIWEKWGPPQERSRLCSIALSGMLLGCFTAI     71 - 140
LIGGFISETLGWPFVFYIFGGVGCVCCLLWFVVIYDDPVSYPWISTSEKEYIISSLKQQVGSSKQPLPIK    141 - 210
AMLRSLPIWSICLGCFSHQWLVSTMVVYIPTYISSVYHVNIRDNGLLSALPFIVAWVIGMVGGYLADFLL    211 - 280
TKKFRLITVRKIATILGSLPSSALIVSLPYLNSGYITATALLTLSCGLSTLCQSGIYINVLDIAPRYSSF    281 - 350
LMGASRGFSSIAPVIVPTVSGFLLSQDPEFGWRNVFFLLFAVNLLGLLFYLIFGEADVQEWAKERKLTRL    351 - 420
//

Text Mined References (23)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
21778665 2011 A novel human organic anion transporter NPT4 mediates the transport of ochratoxin A.
21282933 2011 Functional analysis of human sodium-phosphate transporter 4 (NPT4/SLC17A3) polymorphisms.
20810651 2010 Human sodium phosphate transporter 4 (hNPT4/SLC17A3) as a common renal secretory pathway for drugs and urate.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...