Property Summary

NCBI Gene PubMed Count 16
Grant Count 12
R01 Count 10
Funding $914,748.46
PubMed Score 10.69
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26007630 multiple myeloma risk allele harbours a Thr298Ala missense variant in an ELL2 domain required for transcription elongation
25238757 Loss of ELL2 in B cells results in decreased Igh secretory mRNA and decreased expression of Ig light chain plus genes involved in the unfolded protein response like XBP1, ATF6, BiP, cyclin B2, OcaB (BOB1, Pou2af1).
25058508 Tax transactivates the ELL2 promoter in HTLV-1-infected T-cells.
24565118 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
24367103 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23518577 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23087374 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
23087374 Binding of isolated AFF1(1-308) CBS to CDK9/CycT1 prevents HIV-1 Tat from activating HIV transcription and assembling complete SECs (AFF1, AFF4, ELL2, and ENL). The AFF1(1-308) M60A/L61A mutant shows no suppression of Tat transactivation
22483617 Prostratin and HMBA, two well-studied activators of HIV transcription and latency, enhance ELL2 accumulation and SECs formation largely through decreasing Siah1 expression and ELL2 polyubiquitination.
More...

AA Sequence

MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIP      1 - 70
KNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQ     71 - 140
AEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRV    141 - 210
IHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDR    211 - 280
RSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNG    281 - 350
HLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDS    351 - 420
IYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDL    421 - 490
KREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHA    491 - 560
RMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE    561 - 630
FDQQQAESWS                                                                631 - 640
//

Text Mined References (26)

PMID Year Title
26007630 2015 Variants in ELL2 influencing immunoglobulin levels associate with multiple myeloma.
25238757 2014 Transcription elongation factor ELL2 drives Ig secretory-specific mRNA production and the unfolded protein response.
25058508 2014 The transcription elongation factor ELL2 is specifically upregulated in HTLV-1-infected T-cells and is dependent on the viral oncoprotein Tax.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251033 2013 HIV-1 Tat recruits transcription elongation factors dispersed along a flexible AFF4 scaffold.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22895430 2012 The super elongation complex (SEC) family in transcriptional control.
22483617 2012 The ubiquitin ligase Siah1 controls ELL2 stability and formation of super elongation complexes to modulate gene transcription.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...