Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.49
PubTator Score 9.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (38)

Disease log2 FC p
active Crohn's disease 1.376 7.7e-03
acute quadriplegic myopathy 2.597 2.4e-11
adrenocortical carcinoma -2.009 8.6e-04
adult high grade glioma -1.700 6.4e-03
astrocytic glioma 2.000 1.0e-02
atypical teratoid / rhabdoid tumor -2.300 3.0e-04
Breast cancer 3.100 3.7e-02
chronic lymphosyte leukemia -1.100 7.3e-04
COPD 1.300 1.2e-03
ependymoma -2.000 2.6e-04
glioblastoma -1.700 1.2e-03
group 3 medulloblastoma -2.600 1.0e-03
hepatocellular carcinoma -1.200 1.4e-02
interstitial cystitis 1.500 1.2e-04
interstitial lung disease -1.900 4.2e-02
intraductal papillary-mucinous carcinoma... -1.500 1.2e-02
invasive ductal carcinoma 1.769 1.0e-02
lung adenocarcinoma -1.100 1.0e-05
lung carcinoma -1.300 2.2e-07
medulloblastoma, large-cell -3.500 3.6e-06
mucosa-associated lymphoid tissue lympho... 1.717 1.4e-02
non diabetic and post-ischemic heart fai... -1.300 6.1e-03
non primary Sjogren syndrome sicca -1.500 1.1e-02
non-small cell lung cancer -1.139 1.2e-09
oligodendroglioma -1.300 2.6e-02
osteosarcoma 2.418 1.6e-03
ovarian cancer -1.100 2.5e-02
pancreatic cancer 1.700 3.3e-02
pancreatic carcinoma 1.700 3.3e-02
pancreatic ductal adenocarcinoma liver m... -1.868 3.5e-02
Pick disease -1.300 1.9e-02
pituitary cancer -2.100 9.2e-05
primitive neuroectodermal tumor -1.600 1.8e-06
spina bifida -1.315 2.9e-02
subependymal giant cell astrocytoma 1.095 3.6e-02
tuberculosis -2.600 5.0e-07
type II diabetes mellitus and post-ische... -1.300 3.7e-02
ulcerative colitis 2.200 1.8e-07

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MAAGGTGGLREEQRYGLSCGRLGQDNITVLHVKLTETAIRALETYQSHKNLIPFRPSIQFQGLHGLVKIP      1 - 70
KNDPLNEVHNFNFYLSNVGKDNPQGSFDCIQQTFSSSGASQLNCLGFIQDKITVCATNDSYQMTRERMTQ     71 - 140
AEEESRNRSTKVIKPGGPYVGKRVQIRKAPQAVSDTVPERKRSTPMNPANTIRKTHSSSTISQRPYRDRV    141 - 210
IHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDR    211 - 280
RSLESVLSRKLNPSQNAAGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNG    281 - 350
HLNPTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISHPPQIVNSNSNSPSTPEGRGTQDLPVDSFSQNDS    351 - 420
IYEDQQDKYTSRTSLETLPPGSVLLKCPKPMEENHSMSHKKSKKKSKKHKEKDQIKKHDIETIEEKEEDL    421 - 490
KREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQNYKDDFNAEYDEYRALHA    491 - 560
RMETVARRFIKLDAQRKRLSPGSKEYQNVHEEVLQEYQKIKQSSPNYHEEKYRCEYLHNKLAHIKRLIGE    561 - 630
FDQQQAESWS                                                                631 - 640
//

Text Mined References (30)

PMID Year Title