Property Summary

NCBI Gene PubMed Count 22
Grant Count 27
R01 Count 11
Funding $1,402,169.02
PubMed Score 24.71
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
pancreatic cancer 1.100 0.003
osteosarcoma 2.490 0.000
posterior fossa group B ependymoma 1.600 0.000
group 4 medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.300 0.001
juvenile dermatomyositis 1.389 0.000
acute quadriplegic myopathy 1.225 0.000
pancreatic ductal adenocarcinoma liver m... -1.468 0.004
sarcoidosis 1.200 0.014
diabetes mellitus -1.100 0.001
Breast cancer 2.900 0.029
pancreatic carcinoma 1.100 0.003
ovarian cancer 1.400 0.004

Gene RIF (6)

PMID Text
25298525 Suggest that the exocyst sec10, acting through EGFR, endocytosis, and the MAPK pathway is a candidate therapeutic target for acute kidney injury.
23037926 These data confirm that the exocyst is preferentially involved in basolateral protein translation and translocation, and may well act through the phosphorylation of Sec61beta.
20053792 Exocyst Sec10 overexpression reduces damage to tubular epithelial barriers caused by hydrogen peroxide and speeds the recovery of normal epithelial barrier function after such an injury.
19297529 The exocyst protein Sec10 regulates primary ciliogenesis.
15880602 Observational study of gene-disease association. (HuGE Navigator)
14662749 Data show that GTP-bound ARF6 interacts with Sec10, a subunit of the exocyst complex involved in docking of vesicles with the plasma membrane.

AA Sequence

MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQ      1 - 70
CQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEF     71 - 140
LDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEFTSAQRRGEIS    141 - 210
RMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVF    211 - 280
EIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYI    281 - 350
EVETGYLKSRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL    351 - 420
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQAN    421 - 490
TIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIGQMKHILAAEQKKTDF    491 - 560
KPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGML    561 - 630
AICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRS    631 - 700
ARLARHFS                                                                  701 - 708
//

Text Mined References (28)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25298525 2014 Exocyst Sec10 protects renal tubule cells from injury by EGFR/MAPK activation and effects on endocytosis.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23743675 2013 A meta-analysis of two genome-wide association studies to identify novel loci for maximum number of alcoholic drinks.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23037926 2012 Exocyst Sec10 is involved in basolateral protein translation and translocation in the endoplasmic reticulum.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20053792 2010 Exocyst Sec10 protects epithelial barrier integrity and enhances recovery following oxidative stress, by activation of the MAPK pathway.
More...