Property Summary

NCBI Gene PubMed Count 26
PubMed Score 28.66
PubTator Score 18.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy 1.225 2.4e-05
Breast cancer 2.900 2.9e-02
diabetes mellitus -1.100 1.0e-03
ependymoma 1.100 3.3e-06
group 3 medulloblastoma 1.700 1.3e-03
juvenile dermatomyositis 1.389 1.8e-12
medulloblastoma, large-cell 1.300 1.3e-03
osteosarcoma 2.490 1.1e-06
ovarian cancer 1.300 3.1e-03
pancreatic cancer 1.100 2.8e-03
pancreatic carcinoma 1.100 2.8e-03
pancreatic ductal adenocarcinoma liver m... -1.468 4.3e-03
sarcoidosis 1.200 1.4e-02

Gene RIF (6)

AA Sequence

MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERIQRKVEKLEQQ      1 - 70
CQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEF     71 - 140
LDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSEVKSKIASKYHDLECQLIQEFTSAQRRGEIS    141 - 210
RMREVAAVLLHFKGYSHCVDVYIKQCQEGAYLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVF    211 - 280
EIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYI    281 - 350
EVETGYLKSRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL    351 - 420
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANLYFLDVVQQAN    421 - 490
TIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTLNCMIGQMKHILAAEQKKTDF    491 - 560
KPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVDTVLMELGVRFHRLIYEHLQQYSYSCMGGML    561 - 630
AICDVAEYRKCAKDFKIPMVLHLFDTLHALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRS    631 - 700
ARLARHFS                                                                  701 - 708
//

Text Mined References (34)

PMID Year Title