Property Summary

NCBI Gene PubMed Count 102
PubMed Score 146.21
PubTator Score 96.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
aldosterone-producing adenoma -1.236 1.8e-02
astrocytic glioma -1.100 1.7e-02
colon cancer -2.800 1.9e-02
ependymoma 1.800 1.2e-05
glioblastoma 1.300 5.6e-03
hepatocellular carcinoma 1.300 1.5e-03
intraductal papillary-mucinous carcinoma... -1.600 2.5e-03
invasive ductal carcinoma -1.200 6.1e-03
lung adenocarcinoma -1.300 2.8e-14
lung cancer -1.400 2.2e-03
lung carcinoma -1.700 1.6e-12
malignant mesothelioma -3.700 2.0e-08
medulloblastoma, large-cell 1.400 1.9e-02
non-small cell lung carcinoma -1.200 5.8e-16
osteosarcoma -1.136 2.9e-02
ovarian cancer 1.500 1.2e-03
pancreatic cancer 1.700 2.6e-03
pancreatic carcinoma 1.700 2.6e-03
pediatric high grade glioma 1.100 1.0e-02
psoriasis -1.200 1.4e-07
sonic hedgehog group medulloblastoma 2.000 1.2e-04
spina bifida -1.073 3.8e-02
subependymal giant cell astrocytoma -2.344 2.9e-03

Protein-protein Interaction (2)

Gene RIF (76)

AA Sequence

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDA      1 - 70
LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPE     71 - 140
LDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQ    141 - 210
PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFP    211 - 280
KVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP    281 - 350
DGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM                                  351 - 390
//

Text Mined References (105)

PMID Year Title