Property Summary

NCBI Gene PubMed Count 91
Grant Count 102
R01 Count 83
Funding $9,369,986.67
PubMed Score 130.43
PubTator Score 96.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession O00470 A8MV50
Symbols

Gene

PDB

4XRS  

Gene RIF (65)

PMID Text
26747896 Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML.
26498236 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort.
26206755 It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20.
26130510 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein.
26059450 HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias.
25740828 Data indicate that Meis homeobox 1 (MEIS1) knockdown by lentiviral-shRNA significantly inhibited the growth in leukemia cell lines.
25585874 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
25107888 MEIS1 expression induces lineage commitment towards a megakaryocyte-erythroid progenitor cell fate in common myeloid progenitor cells through activation of genes that define a megakaryocyte-erythroid-specific gene expression program.
24995868 data link MEIS1 loss of function to the etiopathology of RLS, highlight how combined sequencing and systematic functional annotation of rare variation at GWAS loci can detect risk burden
More...

AA Sequence

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDA      1 - 70
LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPE     71 - 140
LDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQ    141 - 210
PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFP    211 - 280
KVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP    281 - 350
DGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM                                  351 - 390
//

Text Mined References (94)

PMID Year Title
26747896 2016 PBX3 and MEIS1 Cooperate in Hematopoietic Cells to Drive Acute Myeloid Leukemias Characterized by a Core Transcriptome of the MLL-Rearranged Disease.
26498236 2015 Genetic associations of periodic limb movements of sleep in the elderly for the MrOS sleep study.
26206755 2015 RE-IIBP Methylates H3K79 and Induces MEIS1-mediated Apoptosis via H2BK120 Ubiquitination by RNF20.
26130510 2015 Dangerous liaisons: cooperation between Pbx3, Meis1 and Hoxa9 in leukemia.
26059450 2015 HOXA9 and MEIS1 gene overexpression in the diagnosis of childhood acute leukemias: Significant correlation with relapse and overall survival.
25740828 2015 MEIS1 regulates an HLF-oxidative stress axis in MLL-fusion gene leukemia.
25585874 2015 Promoter DNA methylation and expression levels of HOXA4, HOXA5 and MEIS1 in acute myeloid leukemia.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
25107888 2014 MEIS1 regulates early erythroid and megakaryocytic cell fate.
More...