Property Summary

NCBI Gene PubMed Count 91
PubMed Score 130.43
PubTator Score 96.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung carcinoma 413 5.81242973082734E-16
lung adenocarcinoma 2714 3.47409000924783E-13
lung carcinoma 2844 1.63887653294504E-12
posterior fossa group B ependymoma 1530 3.62075480413459E-10
malignant mesothelioma 3163 2.00300403908784E-8
sonic hedgehog group medulloblastoma 1482 1.2114947608475E-4
lung cancer 4473 7.79085822695931E-4
ovarian cancer 8492 0.00118230203445068
hepatocellular carcinoma 550 0.00150737818670598
pancreatic cancer 2300 0.00260592420735749
pancreatic carcinoma 567 0.00260592420735752
subependymal giant cell astrocytoma 2287 0.00291556909409323
psoriasis 6685 0.00334476431582418
glioblastoma 5572 0.00560267622218725
invasive ductal carcinoma 2950 0.00614731746227865
pediatric high grade glioma 2712 0.0101160664502255
astrocytic glioma 2241 0.0170794398015794
aldosterone-producing adenoma 664 0.0182853018344533
colon cancer 1475 0.0193959605709407
medulloblastoma, large-cell 6234 0.0194057915835294
osteosarcoma 7933 0.0290305764912355
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0338527019640326
spina bifida 1064 0.0368869036225827
Disease Target Count Z-score Confidence
Restless legs syndrome 28 5.876 2.9
Heart conduction disease 65 0.0 2.0
Disease Target Count Z-score Confidence
Leukemia 88 5.317 2.7
Disease Target Count
Restless legs syndrome 7 1

Expression

  Differential Expression (23)

Synonym

Accession O00470 A8MV50
Symbols

Gene

PDB

4XRS  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA EggNOG

Gene RIF (65)

PMID Text
26747896 Studies implicate PBX3/MEIS1 interaction as a driver of cell transformation and leukemogenesis, and that this axis may play a critical role in the regulation of the core transcriptional programs activated in MLL-rearranged and HOX-overexpressing AML.
26498236 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort.
26206755 It was observed that RE-IIBP induces MEIS1-mediated apoptosis, which was dependent on H2BK120 ubiquitination by RNF20.
26130510 Pbx3 contributes to Hoxa9 leukemogenesis through stabilization of the Meis1 protein.
26059450 HOXA9 and MEIS1 overexpression are inversely correlated with relapse and overall survival, so the genes could become useful predictive markers of the clinical course of pediatric acute leukemias.
25740828 Data indicate that Meis homeobox 1 (MEIS1) knockdown by lentiviral-shRNA significantly inhibited the growth in leukemia cell lines.
25585874 The NK AML patients with NPM1 mutations exhibited elevated HOXA4 methylation and expression levels of HOXA5 and MEIS1 compared with the NPM1 wildtype patients.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
25107888 MEIS1 expression induces lineage commitment towards a megakaryocyte-erythroid progenitor cell fate in common myeloid progenitor cells through activation of genes that define a megakaryocyte-erythroid-specific gene expression program.
24995868 data link MEIS1 loss of function to the etiopathology of RLS, highlight how combined sequencing and systematic functional annotation of rare variation at GWAS loci can detect risk burden
More...

AA Sequence

MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMAPSMGSSVNDA      1 - 70
LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQIRAEKPLFSSNPE     71 - 140
LDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDSEDITRSANLTDQ    141 - 210
PSWNRDHDDTASTRSGGTPGPSSGGHTSHSGDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFP    211 - 280
KVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNP    281 - 350
DGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM                                  351 - 390
//

Text Mined References (94)

PMID Year Title
26747896 2016 PBX3 and MEIS1 Cooperate in Hematopoietic Cells to Drive Acute Myeloid Leukemias Characterized by a Core Transcriptome of the MLL-Rearranged Disease.
26498236 2015 Genetic associations of periodic limb movements of sleep in the elderly for the MrOS sleep study.
26206755 2015 RE-IIBP Methylates H3K79 and Induces MEIS1-mediated Apoptosis via H2BK120 Ubiquitination by RNF20.
26130510 2015 Dangerous liaisons: cooperation between Pbx3, Meis1 and Hoxa9 in leukemia.
26059450 2015 HOXA9 and MEIS1 gene overexpression in the diagnosis of childhood acute leukemias: Significant correlation with relapse and overall survival.
25740828 2015 MEIS1 regulates an HLF-oxidative stress axis in MLL-fusion gene leukemia.
25585874 2015 Promoter DNA methylation and expression levels of HOXA4, HOXA5 and MEIS1 in acute myeloid leukemia.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
25107888 2014 MEIS1 regulates early erythroid and megakaryocytic cell fate.
More...