Property Summary

NCBI Gene PubMed Count 74
PubMed Score 33.93
PubTator Score 30.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cystic fibrosis -1.196 5.2e-05
esophageal adenocarcinoma 1.100 3.8e-02
invasive ductal carcinoma 1.391 8.9e-04
lung cancer 1.200 4.4e-02
malignant mesothelioma -3.000 1.0e-08
osteosarcoma -1.502 7.9e-04
ovarian cancer -3.200 9.5e-10
pancreatic ductal adenocarcinoma liver m... 1.567 1.0e-02
pituitary cancer 1.500 4.0e-03
psoriasis -1.100 3.3e-05
sonic hedgehog group medulloblastoma 1.800 3.3e-04
subependymal giant cell astrocytoma 2.523 8.1e-03

Gene RIF (24)

AA Sequence

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL      1 - 70
SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS     71 - 140
NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE    141 - 210
HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ    211 - 280
LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD    281 - 350
TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA    351 - 420
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS    421 - 490
GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL       491 - 557
//

Text Mined References (76)

PMID Year Title