Property Summary

NCBI Gene PubMed Count 72
Grant Count 11
R01 Count 10
Funding $370,178.15
PubMed Score 33.07
PubTator Score 30.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -3.000 0.000
esophageal adenocarcinoma 1.100 0.038
psoriasis -1.400 0.000
osteosarcoma -1.502 0.001
cystic fibrosis -1.196 0.000
pancreatic ductal adenocarcinoma liver m... 1.567 0.010
lung cancer 1.200 0.044
sonic hedgehog group medulloblastoma 1.800 0.000
subependymal giant cell astrocytoma 2.523 0.008
invasive ductal carcinoma 1.391 0.001
ovarian cancer -3.200 0.000
pituitary cancer 1.500 0.004

Gene RIF (24)

PMID Text
26872428 These findings indicate that miR-26b might influence TRAF5-MAPK signaling pathways to facilitate the malignant progression of melanoma cells.
26454171 RIG-I-like receptor mediated antiviral innate immune responses in the lower respiratory tract involves TRAF3 and TRAF5 signaling.
26453305 findings reveal a direct link between TRAF5-mediated ubiquitination and RORgammat protein regulation
24416204 This study provides evidence that TRAF5 and TRAF3IP2 genes are involved in the development of Behcet's disease (BD) and Vogt-Koyanagi-Harada (VKH) syndrome.
24020968 Data indicate that TNF receptor-associated factor 5 (TRAF5) gene is involved in the development of acute anterior uveitis (AAU) and pediatric uveitis.
23774506 Data indicate that in monocyte- derived macrophages (MDMs) acutely infected with HIV-1 and treated with HCV rCore and HIV-1 rNef, the HIV-1 replication depends on an upstream signal mediated through TRAF2, TRAF5 and TRAF6.
23774506 The interaction of HIV-1 Nef with TRAF2, TRAF5, and TRAF6 proteins activates NF-kappaB, leading to the degradation of IkappaB-alpha and the increased phosphorylation of IKK-alpha and IKK-beta in monocyte-derived macrophages
23774506 The interaction of HIV-1 Nef with TRAF2, TRAF5, and TRAF6 proteins activates NF-kappaB, leading to the degradation of IkappaB-alpha and the increased phosphorylation of IKK-alpha and IKK-beta in monocyte-derived macrophages
23329887 TRAF3 and TRAF5 are overexpressed in inflammatory bowel disease
22593207 Numbl interacted with tumor necrosis factor receptor-associated factor 5, which signals upstream and is required for the activation of NF-kappaB, and committed it to proteasomal degradation by promoting K48-linked polyubiquitination of TRAF5
More...

AA Sequence

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCIL      1 - 70
SLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCS     71 - 140
NEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDE    141 - 210
HLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQ    211 - 280
LAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVD    281 - 350
TVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREA    351 - 420
VDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQS    421 - 490
GKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDLTDLEDL       491 - 557
//

Text Mined References (74)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26872428 2016 MiR-26b inhibits melanoma cell proliferation and enhances apoptosis by suppressing TRAF5-mediated MAPK activation.
26454171 2015 Retinoic acid-inducible gene-I-like receptor (RLR)-mediated antiviral innate immune responses in the lower respiratory tract: Roles of TRAF3 and TRAF5.
26453305 2015 TRAF5-mediated Lys-63-linked Polyubiquitination Plays an Essential Role in Positive Regulation of ROR?t in Promoting IL-17A Expression.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24416204 2014 TRAF5 and TRAF3IP2 gene polymorphisms are associated with Behçet's disease and Vogt-Koyanagi-Harada syndrome: a case-control study.
24020968 2013 TNF receptor-associated factor 5 gene confers genetic predisposition to acute anterior uveitis and pediatric uveitis.
23774506 2013 HIV-1 Nef interacts with HCV Core, recruits TRAF2, TRAF5 and TRAF6, and stimulates HIV-1 replication in macrophages.
23329887 2013 Up-regulation and pre-activation of TRAF3 and TRAF5 in inflammatory bowel disease.
More...