Property Summary

NCBI Gene PubMed Count 13
PubMed Score 103.19
PubTator Score 57.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
malignant mesothelioma 3163 1.10167238808515E-8
osteosarcoma 7933 1.84995696960675E-8
ovarian cancer 8492 1.15279513275893E-7
psoriasis 6685 0.00103272428485047
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 2.0
Primary biliary cirrhosis 45 0.0 2.0
Disease Target Count Z-score Confidence
beta-mannosidosis 9 7.333 3.7
Disease Target Count
Beta-D-mannosidosis 1
Disease Target Count
Mannosidosis, beta A, lysosomal 1

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
psoriasis -1.700 0.001
osteosarcoma -2.509 0.000
ovarian cancer 1.800 0.000

Synonym

Accession O00462 Q96BC3 Q9NYX9
Symbols MANB1

Gene

PANTHER Protein Class (2)

  Ortholog (12)

Gene RIF (27)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
20332099 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19728872 The present analysis of the c.1922G>A MANBA mutation underlines the lack of genotype-phenotype correlation in beta-mannosidosis
18854154 Knockdown of mannosidase, beta A (MANBA, lysosomal) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18330979 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18314154 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18215327 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
17899454 The MANBA genotypes for a polymorphic CA repeat were related to colorectal cancer risk in a Swedish population but not a Chinese one. In the Swedish population, individuals with < 22 CAs/< 22 CAs had a significantly increased risk for CRC.
17899454 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRLHLLLLLALCGAGTTAAELSYSLRGNWSICNGNGSLELPGAVPGCVHSALFQQGLIQDSYYRFNDLNY      1 - 70
RWVSLDNWTYSKEFKIPFEISKWQKVNLILEGVDTVSKILFNEVTIGETDNMFNRYSFDITNVVRDVNSI     71 - 140
ELRFQSAVLYAAQQSKAHTRYQVPPDCPPLVQKGECHVNFVRKEQCSFSWDWGPSFPTQGIWKDVRIEAY    141 - 210
NICHLNYFTFSPIYDKSAQEWNLEIESTFDVVSSKPVGGQVIVAIPKLQTQQTYSIELQPGKRIVELFVN    211 - 280
ISKNITVETWWPHGHGNQTGYNMTVLFELDGGLNIEKSAKVYFRTVELIEEPIKGSPGLSFYFKINGFPI    281 - 350
FLKGSNWIPADSFQDRVTSELLRLLLQSVVDANMNTLRVWGGGIYEQDEFYELCDELGIMVWQDFMFACA    351 - 420
LYPTDQGFLDSVTAEVAYQIKRLKSHPSIIIWSGNNENEEALMMNWYHISFTDRPIYIKDYVTLYVKNIR    421 - 490
ELVLAGDKSRPFITSSPTNGAETVAEAWVSQNPNSNYFGDVHFYDYISDCWNWKVFPKARFASEYGYQSW    491 - 560
PSFSTLEKVSSTEDWSFNSKFSLHRQHHEGGNKQMLYQAGLHFKLPQSTDPLRTFKDTIYLTQVMQAQCV    561 - 630
KTETEFYRRSRSEIVDQQGHTMGALYWQLNDIWQAPSWASLEYGGKWKMLHYFAQNFFAPLLPVGFENEN    631 - 700
TFYIYGVSDLHSDYSMTLSVRVHTWSSLEPVCSRVTERFVMKGGEAVCLYEEPVSELLRRCGNCTRESCV    701 - 770
VSFYLSADHELLSPTNYHFLSSPKEAVGLCKAQITAIISQQGDIFVFDLETSAVAPFVWLDVGSIPGRFS    771 - 840
DNGFLMTEKTRTILFYPWEPTSKNELEQSFHVTSLTDIY                                   841 - 879
//

Text Mined References (13)

PMID Year Title
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19728872 2009 A MANBA mutation resulting in residual beta-mannosidase activity associated with severe leukoencephalopathy: a possible pseudodeficiency variant.
17899454 2008 MANBA polymorphism was related to increased risk of colorectal cancer in Swedish but not in Chinese populations.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...