Property Summary

NCBI Gene PubMed Count 17
PubMed Score 26.03
PubTator Score 27.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 4.35536642121542E-13
ovarian cancer 8492 1.78072810794866E-6
lung cancer 4473 1.5900409887449E-5
ependymoma 2514 3.14223966772273E-4
group 4 medulloblastoma 1875 6.80204108951118E-4
medulloblastoma, large-cell 6234 0.00167591271736737
psoriasis 6685 0.0017098775960353
adult high grade glioma 2148 0.00206050030824826
pilocytic astrocytoma 3086 0.00220214682392385
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00243515216051211
primary pancreatic ductal adenocarcinoma 1271 0.00301621260563461
astrocytoma 1493 0.00308641095292742
Pick disease 1893 0.0112752053008652
hereditary spastic paraplegia 313 0.0158324098521926
Gaucher disease type 3 76 0.021440053020925
Rheumatoid Arthritis 1171 0.0229944175536714
glioblastoma 5572 0.0256903168936058
subependymal giant cell astrocytoma 2287 0.0265670834285123
esophageal adenocarcinoma 737 0.0400986259417219

Expression

  Differential Expression (19)

Synonym

Accession O00461
Symbols P138
GIMPC
GOLPH4
GPP130

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Process (1)

Gene RIF (6)

PMID Text
26446839 Findings suggest the unexpected presence of quality control in the Golgi that recognizes aggregated Golgi proteins, GPP130, and targets them for degradation in lysosomes.
23761068 Characteristics of GPP130 and its STx/STx1 binding interface.
20130081 the stem domain of GPP130 is a novel Mn sensor in the Golgi lumen of mammalian cells
17605763 Multiple pH-regulated steps affect the trafficking of GPP130.
15331763 GPP130 mediates exit from endosomes and thereby underlies Shiga toxin invasion and retrieval-based targeting of other cycling Golgi proteines
12207053 both the translation and transcription are regulated independent of the cell cycle and dissociated from the duplication of the centrosome

AA Sequence

MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSR      1 - 70
LEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHR     71 - 140
KQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEH    141 - 210
EQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQ    211 - 280
EVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQ    281 - 350
VGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQ    351 - 420
VEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDI    421 - 490
VQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGED    491 - 560
EFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKK    561 - 630
RELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM        631 - 696
//

Text Mined References (22)

PMID Year Title
26446839 2015 Induced oligomerization targets Golgi proteins for degradation in lysosomes.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23761068 2013 Shiga toxin-binding site for host cell receptor GPP130 reveals unexpected divergence in toxin-trafficking mechanisms.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21269460 2011 Initial characterization of the human central proteome.
20130081 2010 Manganese-induced trafficking and turnover of the cis-Golgi glycoprotein GPP130.
19946888 2010 Defining the membrane proteome of NK cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
More...