Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.24
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.800 2.1e-03
astrocytoma 1.100 5.3e-06
Astrocytoma, Pilocytic 1.200 3.9e-03
ependymoma 1.200 3.1e-04
esophageal adenocarcinoma 1.100 4.0e-02
Gaucher disease type 3 1.300 2.1e-02
glioblastoma 1.100 2.8e-03
group 4 medulloblastoma -1.400 5.8e-03
hereditary spastic paraplegia -1.147 1.6e-02
intraductal papillary-mucinous carcinoma... 1.400 2.4e-03
lung cancer 1.700 1.6e-05
medulloblastoma, large-cell 1.300 1.7e-03
oligodendroglioma 1.100 4.4e-13
ovarian cancer -1.500 7.1e-04
Pick disease 1.700 1.1e-02
primary pancreatic ductal adenocarcinoma 1.451 3.0e-03
psoriasis -1.900 1.7e-03
Rheumatoid arthritis 1.500 2.3e-02
subependymal giant cell astrocytoma 2.307 2.7e-02

 GO Process (1)

Gene RIF (7)

AA Sequence

MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSR      1 - 70
LEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHR     71 - 140
KQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEH    141 - 210
EQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQ    211 - 280
EVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQ    281 - 350
VGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQ    351 - 420
VEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDI    421 - 490
VQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGED    491 - 560
EFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKK    561 - 630
RELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM        631 - 696
//

Text Mined References (23)

PMID Year Title