Property Summary

NCBI Gene PubMed Count 17
Grant Count 17
R01 Count 6
Funding $1,920,093.83
PubMed Score 26.03
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

 GO Process (1)

Gene RIF (6)

PMID Text
26446839 Findings suggest the unexpected presence of quality control in the Golgi that recognizes aggregated Golgi proteins, GPP130, and targets them for degradation in lysosomes.
23761068 Characteristics of GPP130 and its STx/STx1 binding interface.
20130081 the stem domain of GPP130 is a novel Mn sensor in the Golgi lumen of mammalian cells
17605763 Multiple pH-regulated steps affect the trafficking of GPP130.
15331763 GPP130 mediates exit from endosomes and thereby underlies Shiga toxin invasion and retrieval-based targeting of other cycling Golgi proteines
12207053 both the translation and transcription are regulated independent of the cell cycle and dissociated from the duplication of the centrosome

AA Sequence

MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYYELQTQLRKAEAVALKYQQHQESLSAQLQVVYEHRSR      1 - 70
LEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGRQDSNSRYSALNVQHQMLKSQHEELKKQHSDLEEEHR     71 - 140
KQGEDFSRTFNDHKQKYLQLQQEKEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEH    141 - 210
EQLVVTLEDHKSALAAAQTQVAEYKQLKDTLNRIPSLRKPDPAEQQNVTQVAHSPQGYNTAREKPTREVQ    211 - 280
EVSRNNDVWQNHEAVPGRAEDTKLYAPTHKEAEFQAPPEPIQQEVERREPEEHQVEEEHRKALEEEEMEQ    281 - 350
VGQAEHLEEEHDPSPEEQDREWKEQHEQREAANLLEGHARAEVYPSAKPMIKFQSPYEEQLEQQRLAVQQ    351 - 420
VEEAQQLREHQEALHQQRLQGHLLRQQEQQQQQVAREMALQRQAELEEGRPQHQEQLRQQAHYDAMDNDI    421 - 490
VQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGED    491 - 560
EFEEAEQVREENLPDENEEQKQSNQKQENTEVEEHLVMAGNPDQQEDNVDEQYQEEAEEEVQEDLTEEKK    561 - 630
RELEHNAEETYGENDENTDDKNNDGEEQEVRDDNRPKGREEHYEEEEEEEEDGAAVAEKSHRRAEM        631 - 696
//

Text Mined References (22)

PMID Year Title
26446839 2015 Induced oligomerization targets Golgi proteins for degradation in lysosomes.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25087078 2014 Genetic determinants of common epilepsies: a meta-analysis of genome-wide association studies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23761068 2013 Shiga toxin-binding site for host cell receptor GPP130 reveals unexpected divergence in toxin-trafficking mechanisms.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21269460 2011 Initial characterization of the human central proteome.
20130081 2010 Manganese-induced trafficking and turnover of the cis-Golgi glycoprotein GPP130.
19946888 2010 Defining the membrane proteome of NK cells.
18391951 2008 Many sequence variants affecting diversity of adult human height.
More...