Property Summary

NCBI Gene PubMed Count 36
Grant Count 21
R01 Count 15
Funding $3,644,624.01
PubMed Score 32.49
PubTator Score 23.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (24)

PMID Text
26397160 rs7817 polymorphism associated with nasal polyposis in cystic fibrosis patients
26055519 study reveals an EGFR-IFRD1-mediated viral immune evasion mechanism, which can also be exploited by cancer cells
25939412 rs5009270 may contribute to hip OA susceptibility by altering proximal femur shape.
25308091 PC4 plays essential roles in the transition step from transcription initiation to elongation by binding to melted DNA in collaboration with TFIIEbeta.
25073439 Studied the association between IFRD1 polymorphisms and gastric cancer in a Chinese population.
23043087 IFRD1 expression is systemically up-regulated in CF neutrophils, is linked to the production of ROS, and is modulated by chemokines in CF airway fluids, depending on the IFRD1 genotype.
21723850 This work provides evidence for the first time of reduced level of IFRD1 protein in murine and human F508del-CFTR airway epithelial cell models.
21555518 IFRD1 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
21127072 IFRD1 is an inducer of skeletal muscle regeneration and of satellite cell amplification, by regulating MyoD and NF-kB.
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV      1 - 70
LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD     71 - 140
EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS    141 - 210
TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV    211 - 280
NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD    281 - 350
FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF    351 - 420
ERHLYNSAAFKARTKARSKCRDKRADVGEFF                                           421 - 451
//

Text Mined References (40)

PMID Year Title
26397160 2015 IFRD1 gene polymorphisms are associated with nasal polyposis in cystic fibrosis patients.
26055519 2015 The interferon-related developmental regulator 1 is used by human papillomavirus to suppress NF?B activation.
25939412 2015 Investigation of association between hip osteoarthritis susceptibility loci and radiographic proximal femur shape.
25621764 2015 Translation of 5' leaders is pervasive in genes resistant to eIF2 repression.
25308091 2014 Transcription cofactor PC4 plays essential roles in collaboration with the small subunit of general transcription factor TFIIE.
25073439 2014 IFRD1 polymorphisms and gastric cancer risk in a Chinese population.
23989986 2014 A meta-analysis of genome-wide association studies identifies novel variants associated with osteoarthritis of the hip.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23043087 2013 Expression and regulation of interferon-related development regulator-1 in cystic fibrosis neutrophils.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
More...