Property Summary

NCBI Gene PubMed Count 38
PubMed Score 36.09
PubTator Score 23.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
cystic fibrosis -1.407 4.3e-05
acute myeloid leukemia 1.100 2.2e-02
Breast cancer -3.000 2.8e-54
dermatomyositis 2.100 8.8e-04
glioblastoma 1.500 1.7e-02
group 3 medulloblastoma 1.100 2.1e-02
hepatocellular carcinoma -1.400 1.5e-04
interstitial lung disease -1.500 4.7e-02
intraductal papillary-mucinous adenoma (... -1.900 5.9e-04
intraductal papillary-mucinous carcinoma... -1.400 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.500 1.8e-02
juvenile dermatomyositis 1.331 1.2e-06
lung cancer -1.200 3.3e-04
Multiple myeloma 1.340 1.6e-02
nasopharyngeal carcinoma 1.100 4.1e-03
spina bifida -1.134 4.5e-02
subependymal giant cell astrocytoma 1.334 4.1e-02

Gene RIF (26)

AA Sequence

MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEV      1 - 70
LDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSD     71 - 140
EQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYS    141 - 210
TLECLENIFTKSYLKEKDTTVICSTPNTVLHISSLLAWTLLLTICPINEVKKKLEMHFHKLPSLLSCDDV    211 - 280
NMRIAAGESLALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEERD    281 - 350
FPTETIKFGPERMYIDCWVKKHTYDTFKEVLGSGMQYHLQSNEFLRNVFELGPPVMLDAATLKTMKISRF    351 - 420
ERHLYNSAAFKARTKARSKCRDKRADVGEFF                                           421 - 451
//

Text Mined References (42)

PMID Year Title