Property Summary

NCBI Gene PubMed Count 38
PubMed Score 0.00
PubTator Score 37.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.049 1.7e-02
Astrocytoma, Pilocytic 1.100 1.6e-06
chronic lymphosyte leukemia -1.300 6.4e-09
glioblastoma 1.100 2.9e-02
group 4 medulloblastoma -1.100 7.2e-04
interstitial cystitis 1.400 2.8e-03
invasive ductal carcinoma 1.086 1.7e-03
lung adenocarcinoma -1.192 1.1e-05
lung cancer -1.200 3.9e-02
lung carcinoma -1.800 4.3e-23
medulloblastoma, large-cell -1.200 5.7e-04
non-small cell lung cancer -2.028 1.3e-21
osteosarcoma -2.736 1.3e-03
ovarian cancer -1.300 5.3e-06
primary pancreatic ductal adenocarcinoma 1.202 5.9e-03
psoriasis -1.100 1.2e-02
spina bifida 1.093 1.6e-02
subependymal giant cell astrocytoma 1.365 1.7e-02
tuberculosis 1.600 3.1e-06
ulcerative colitis 1.100 2.9e-03

Gene RIF (24)

AA Sequence

MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP      1 - 70
DLRGRDKRGTKEDPRADYACIAENKPT                                                71 - 97
//

Text Mined References (41)

PMID Year Title