Property Summary

NCBI Gene PubMed Count 38
PubMed Score 0.00
PubTator Score 37.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis -1.100 0.012
osteosarcoma -3.004 0.001
chronic lymphosyte leukemia -1.900 0.000
glioblastoma 1.800 0.009
medulloblastoma, large-cell -1.200 0.001
adrenocortical carcinoma -1.049 0.017
tuberculosis and treatment for 3 months 1.700 0.000
primary pancreatic ductal adenocarcinoma 1.202 0.006
non-small cell lung cancer -2.058 0.000
lung cancer -2.200 0.000
interstitial cystitis 1.600 0.002
group 4 medulloblastoma -1.100 0.001
pilocytic astrocytoma 1.600 0.000
subependymal giant cell astrocytoma 1.618 0.024
invasive ductal carcinoma 1.086 0.002
lung adenocarcinoma -1.192 0.000
lung carcinoma -1.800 0.000
spina bifida 1.240 0.006
ulcerative colitis 1.500 0.000
ovarian cancer -1.300 0.000

Gene RIF (24)

PMID Text
27384923 Increased expression of LST1 in GC-responders before therapy warrants further investigation into their role as potential predictors for the response to GC, and in the inflammatory process of rheumatoid arthritis.
24816991 Data indicate that the MHC class III gene LST1 5' untranslated regions (5'-UTR) contains several upstream open reading frames (uORFs).
24803336 Psoriasis was associated with promoter variant, rs9267502 of LST1.Promoter activity was examined and it was larger than that of the other genetic variants, most probably due to changes in binding affinity to transcription factors.
24682411 This is the first report demonstrating regulated LST1 expression in human intestinal epithelial and microvascular endothelial cells and in inflamed colonic tissue from IBD patients.
23239025 induces the formation of functional nanotubes
22589543 LST1 is expressed specifically in leukocytes of the myeloid lineage, where it localizes to the tetraspanin-enriched microdomains andit binds SHP-1 and SHP-2 phosphatases.
20854863 Observational study of gene-disease association. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20668555 Study found association between extended LTA, TNF, LST1 and HLA gene haplotypes and rubella vaccine-induced immunity.
20668555 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWAQGSSEQELHYASLQRLPVPSSEGP      1 - 70
DLRGRDKRGTKEDPRADYACIAENKPT                                                71 - 97
//

Text Mined References (41)

PMID Year Title
27384923 Expression of ERAP2 and LST1 is increased before start of therapy in rheumatoid arthritis patients with good clinical response to glucocorticoids.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24816991 2014 An upstream open reading frame regulates LST1 expression during monocyte differentiation.
24803336 2014 Identification of functional haplotypes in the promoter region of the LST1 gene.
24682411 2014 Regulated expression of leukocyte-specific transcript (LST) 1 in human intestinal inflammation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23239025 2013 LST1 promotes the assembly of a molecular machinery responsible for tunneling nanotube formation.
22589543 2012 LST1/A is a myeloid leukocyte-specific transmembrane adaptor protein recruiting protein tyrosine phosphatases SHP-1 and SHP-2 to the plasma membrane.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20854863 2010 Characterization of tumor necrosis factor-? block haplotypes associated with susceptibility to chronic venous leg ulcers in Caucasian patients.
More...