Property Summary

NCBI Gene PubMed Count 28
Grant Count 1
Funding $105,632.4
PubMed Score 8.95
PubTator Score 27.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.900 0.000
medulloblastoma -1.500 0.005
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.500 0.004
pediatric high grade glioma -1.500 0.000
pilocytic astrocytoma -1.400 0.000
invasive ductal carcinoma -1.100 0.003
pituitary cancer 1.200 0.010

Synonym

Accession O00451 E9PD47 O15316 O15328 Q58J92 Q6GTR9 Q7Z5C2 GDNF receptor alpha-2
Symbols NTNRA
RETL2
TRNR2
GDNFRB
NRTNR-ALPHA

Gene

 Grant Application (1)

Gene RIF (18)

PMID Text
24974787 GFRA2 variants associated with diabetic neuropathic pain.
24402129 GFRalpha2 is under-expressed in functioning adenomas and over-expressed in non-functioning adenomas, specifically gonadotropinomas
24139947 In the cochlea, immunolabeling for GFRalpha-2 receptors was identified mainly in the cell bodies of the spiral neurons than in the nerve fibers. No structures in the organ of Corti were labeled with GFRalpha-2 receptor antibody
24067900 GFRalpha-2 is associated with severe abdominal pain sensation in pancreatic cancer patients.
23881409 The study shows co-localization of RET with GFRA1 and GFRA2 in myenteric ganglia of the adult human colon.
21723942 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFRalpha2 isoforms.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20369355 GFRA2 genetic variants, and age, may play a role in susceptibility to tardive dyskinesia.
20369355 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20116071 This study found nominally-significant evidence for interactions between GFRA1, 2 and 3 associated with schizophrenia and clozapine response, consistent with the locations of these three genes within linkage regions for schizophrenia.
More...

AA Sequence

MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRN      1 - 70
TMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFR     71 - 140
LASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDR    141 - 210
VPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQ    211 - 280
TVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRN    281 - 350
AIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSM    351 - 420
CFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL                              421 - 464
//

Text Mined References (29)

PMID Year Title
24974787 2015 A genome-wide association study suggests an association of Chr8p21.3 (GFRA2) with diabetic neuropathic pain.
24402129 2015 Expression of the pituitary stem/progenitor marker GFR?2 in human pituitary adenomas and normal pituitary.
24139947 2014 Immunohistological analysis of neurturin and its receptors in human cochlea.
24067900 2014 The neurotrophic factor neurturin contributes toward an aggressive cancer cell phenotype, neuropathic pain and neuronal plasticity in pancreatic cancer.
23881409 2013 Site-specific gene expression and localization of growth factor ligand receptors RET, GFR?1 and GFR?2 in human adult colon.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
21723942 2011 Cyclic AMP signalling through PKA but not Epac is essential for neurturin-induced biphasic ERK1/2 activation and neurite outgrowths through GFR?2 isoforms.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20369355 2010 Glial cell line-derived neurotrophic factor receptor alpha 2 (GFRA2) gene is associated with tardive dyskinesia.
More...