Property Summary

NCBI Gene PubMed Count 30
PubMed Score 8.45
PubTator Score 27.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 2.4e-03
Astrocytoma, Pilocytic -1.300 9.5e-06
atypical teratoid / rhabdoid tumor -2.000 2.7e-09
glioblastoma -1.400 2.6e-06
group 4 medulloblastoma -1.200 3.3e-03
invasive ductal carcinoma -1.100 3.4e-03
medulloblastoma, large-cell -1.700 6.1e-04
pituitary cancer 1.200 1.0e-02
primitive neuroectodermal tumor -1.500 4.1e-03

Gene RIF (20)

AA Sequence

MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRN      1 - 70
TMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFR     71 - 140
LASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDR    141 - 210
VPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQ    211 - 280
TVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENPCLRN    281 - 350
AIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLKANNSKELSM    351 - 420
CFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVLMLKLAL                              421 - 464
//

Text Mined References (31)

PMID Year Title