Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.66
PubTator Score 6.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.800 2.8e-03
astrocytic glioma -1.100 8.3e-03
Astrocytoma, Pilocytic -1.900 3.5e-05
atypical teratoid / rhabdoid tumor -1.400 5.2e-06
ependymoma -1.200 1.5e-02
glioblastoma -1.700 2.6e-07
group 3 medulloblastoma -1.700 3.0e-02
lung carcinoma 2.000 5.7e-40
medulloblastoma, large-cell -1.500 1.4e-03
oligodendroglioma -1.600 1.5e-24
Pick disease -1.300 3.5e-04
psoriasis 2.300 2.5e-46

Gene RIF (4)

AA Sequence

MFPEPPTPGPPSPDTPPDSSRISHGPVPPWALATIVLVSGLLIFSCCFCLYRKSCRRRTGKKSQAQAQVH      1 - 70
LQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLLVGILQAMGLAALDL     71 - 140
GGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEV    141 - 210
RVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVK    211 - 280
VHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAG    281 - 350
GAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP                                      351 - 386
//

Text Mined References (15)

PMID Year Title