Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.66
PubTator Score 6.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -1.500 0.000
ependymoma -1.700 0.000
glioblastoma -1.800 0.000
oligodendroglioma -1.600 0.000
group 3 medulloblastoma -1.700 0.030
atypical teratoid/rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.800 0.001
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma 2.000 0.000
Pick disease -1.300 0.000
psoriasis 2.300 0.000

Gene RIF (3)

PMID Text
22102235 crystals of synaptotagmin 5 belonged to the hexagonal space group P6(5), with unit-cell parameters a = b = 93.97, c = 28.05 A.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
15820774 results suggest a novel putative functional role for the GST-synaptotagmin V complex in human breast cancers. As this association of GST M1-synaptotagmin was not seen in adjacent non-cancerous tissues, this can be used as a marker for breast cancers.

AA Sequence

MFPEPPTPGPPSPDTPPDSSRISHGPVPPWALATIVLVSGLLIFSCCFCLYRKSCRRRTGKKSQAQAQVH      1 - 70
LQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGRLQYSLDYDFQSGQLLVGILQAMGLAALDL     71 - 140
GGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEV    141 - 210
RVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVK    211 - 280
VHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAG    281 - 350
GAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP                                      351 - 386
//

Text Mined References (14)

PMID Year Title
22102235 2011 Cloning, expression, purification, crystallization and preliminary X-ray diffraction crystallographic study of human synaptotagmin 5 C2A domain.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15820774 2005 Evidence for the association of synaptotagmin with glutathione S-transferases: implications for a novel function in human breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10734137 2000 SYNCRIP, a cytoplasmic counterpart of heterogeneous nuclear ribonucleoprotein R, interacts with ubiquitous synaptotagmin isoforms.
More...