Property Summary

NCBI Gene PubMed Count 70
Grant Count 27
R01 Count 18
Funding $3,015,705.33
PubMed Score 180.37
PubTator Score 107.26

Knowledge Summary

Patent (22,179)

Expression

  Differential Expression (18)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (49)

PMID Text
26481051 We demonstrate that centrioles promote PLK4 activation through its recruitment and local accumulation. Though centriole removal reduces the proportion of active PLK4, this is rescued by concentrating PLK4 to the peroxisome lumen
26439168 KLF14 transcription is significantly downregulated, whereas Plk4 transcription is upregulated in multiple types of cancers, and there exists an inverse correlation between KLF14 and Plk4 protein expression in human breast and colon cancers.
26188084 The authors suggest that the STIL-coiled-coil region/PLK4 interaction mediates PLK4 activation as well as stabilization of centriolar PLK4 and plays a key role in centriole duplication.
26101219 Plk4 activity promotes the recruitment of STIL to the centriole and primes the direct binding of STIL to the C terminus of SAS6.
25859044 identified association between aneuploidy of putative mitotic origin and linked genetic variants on chromosome 4 of maternal genomes; associated region contains candidate gene,PLK4, that plays a role in centriole duplication and can alter mitotic fidelity upon minor dysregulation
25795303 these results identify the interaction between Mib1 and Plk4 as a new and important element in the control of centriole homeostasis.
25723005 Data suggest polo-like kinase 4 (PLK4) inhibitors as a clinical candidate for cancer therapy.
25590559 PLK4 functions downstream of ROCK2 to drive centrosome amplification in arrested cells.
25347426 Decreased PLK4 protein expression due to promoter hypermethylation was negatively correlated with JAK2 overexpression, a common occurrence in hematological malignancies.
25344692 different levels of impaired PLK4 activity result in growth and cilia phenotypes, providing a mechanism by which microcephaly disorders can occur with or without ciliopathic features
More...

AA Sequence

MATCIGEKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKKAMYKAGMVQRVQNEVKIHCQLKHP      1 - 70
SILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHSHGILHRDLTLS     71 - 140
NLLLTRNMNIKIADFGLATQLKMPHEKHYTLCGTPNYISPEIATRSAHGLESDVWSLGCMFYTLLIGRPP    141 - 210
FDTDTVKNTLNKVVLADYEMPSFLSIEAKDLIHQLLRRNPADRLSLSSVLDHPFMSRNSSTKSKDLGTVE    211 - 280
DSIDSGHATISTAITASSSTSISGSLFDKRRLLIGQPLPNKMTVFPKNKSSTDFSSSGDGNSFYTQWGNQ    281 - 350
ETSNSGRGRVIQDAEERPHSRYLRRAYSSDRSGTSNSQSQAKTYTMERCHSAEMLSVSKRSGGGENEERY    351 - 420
SPTDNNANIFNFFKEKTSSSSGSFERPDNNQALSNHLCPGKTPFPFADPTPQTETVQQWFGNLQINAHLR    421 - 490
KTTEYDSISPNRDFQGHPDLQKDTSKNAWTDTKVKKNSDASDNAHSVKQQNTMKYMTALHSKPEIIQQEC    491 - 560
VFGSDPLSEQSKTRGMEPPWGYQNRTLRSITSPLVAHRLKPIRQKTKKAVVSILDSEEVCVELVKEYASQ    561 - 630
EYVKEVLQISSDGNTITIYYPNGGRGFPLADRPPSPTDNISRYSFDNLPEKYWRKYQYASRFVQLVRSKS    631 - 700
PKITYFTRYAKCILMENSPGADFEVWFYDGVKIHKTEDFIQVIEKTGKSYTLKSESEVNSLKEEIKMYMD    701 - 770
HANEGHRICLALESIISEEERKTRSAPFFPIIIGRKPGSTSSPKALSPPPSVDSNYPTRERASFNRMVMH    771 - 840
SAASPTQAPILNPSMVTNEGLGLTTTASGTDISSNSLKDCLPKSAQLLKSVFVKNVGWATQLTSGAVWVQ    841 - 910
FNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH              911 - 970
//

Text Mined References (79)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26481051 2015 PLK4 trans-Autoactivation Controls Centriole Biogenesis in Space.
26439168 2015 Loss of KLF14 triggers centrosome amplification and tumorigenesis.
26188084 2015 STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
26101219 2015 Binding of STIL to Plk4 activates kinase activity to promote centriole assembly.
25859044 2015 Common variants spanning PLK4 are associated with mitotic-origin aneuploidy in human embryos.
25795303 2015 The E3 ubiquitin ligase Mib1 regulates Plk4 and centriole biogenesis.
25723005 2015 The discovery of Polo-like kinase 4 inhibitors: identification of (1R,2S).2-(3-((E).4-(((cis).2,6-dimethylmorpholino)methyl)styryl). 1H.indazol-6-yl)-5?'-methoxyspiro[cyclopropane-1,3?'-indolin]-2?'-one (CFI-400945) as a potent, orally active antitumor agent.
25590559 2015 Functional relationship among PLK2, PLK4 and ROCK2 to induce centrosome amplification.
25416956 2014 A proteome-scale map of the human interactome network.
More...