Property Summary

NCBI Gene PubMed Count 48
Grant Count 69
R01 Count 35
Funding $9,752,977.92
PubMed Score 3052.46
PubTator Score 1137.53

Knowledge Summary

Patent (24,803)

Expression

Synonym

Accession O00443 B0LPH2 B4E2G4 Q14CQ9 PI3K-C2-alpha
Symbols CPK
PI3-K-C2A
PI3K-C2alpha
PI3K-C2-alpha
PI3-K-C2(ALPHA)

Gene

PANTHER Protein Class (2)

PDB

2AR5   2IWL   2REA   2RED  

Gene RIF (60)

PMID Text
26387957 PI3KC2a knockdown results in rerouting of insulin signaling and pancreatic beta cell proliferation.
26175229 MiR-206 regulates endothelial progenitor cell activities by targeting PIK3C2alpha expression.The role of PIK3C2alpha in endothelial progenitor cell function in coronary artery disease
25779105 PI3KC2alpha has a role in regulating shear-dependent platelet adhesion via regulation of membrane structure, rather than acute signalling
25667265 a model of S. flexneri dissemination is proposed in which the formation of vacuole-like protrusions is mediated by the PIK3C2A-dependent production of the signaling lipid phosphatidylinositol 3-phosphate in the protrusion membrane
25614622 These observations indicate that PI3K-C2alpha plays the pivotal role in TGFbeta receptor endocytosis and thereby Smad2/3 signaling, participating in angiogenic actions of TGFbeta.
25233418 Data (including data from knockout mice) suggest that PI3KC2a participates in tumor angiogenesis. [REVIEW]
24073214 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23320105 Class II enzyme PI3K-C2beta and the class IB isozyme p110gamma mainly regulate the S1P- and high density lipoprotein (HDL)-dependent endothelial cell (EC) migration and PI3K-C2alpha primarily controls EC survival
23301033 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
23251686 HIV-1 Tat induces phosphorylation of PI3K, AKT, PTEN, and GSK-3beta activating PI3K and AKT and inactivating PTEN and GSK-3beta in vIL-6 expressing cells
More...

AA Sequence

MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNK      1 - 70
QDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRG     71 - 140
QWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQG    141 - 210
SLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPK    211 - 280
VDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQ    281 - 350
GHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE    351 - 420
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQNNHCLGSH    421 - 490
EHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKPCKEAMTRHPVEELLDSYHNQ    491 - 560
VELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESVKKLKRAVNLPRSKTADVTSLFGGEDTSRSS    561 - 630
TRGSLNPENPVQVSINQLTAAIYDLLRLHANSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNW    631 - 700
VSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQ    701 - 770
SSGSSPDSNKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF    771 - 840
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCFKHPNCLP    841 - 910
KILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAVTWIEAISDDELTDLLPQFVQ    911 - 980
ALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHDVQFSTRYEHVLGALLSVGGKRLREELLKQT    981 - 1050
KLVQLLGGVAEKVRQASGSARQVVLQRSMERVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLK   1051 - 1120
VTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPAS   1121 - 1190
DTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS   1191 - 1260
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLF   1261 - 1330
LNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSG   1331 - 1400
LPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELH   1401 - 1470
NKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKA   1471 - 1540
EGIARSADAGSFSPTPGQIGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKR   1541 - 1610
KTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL   1611 - 1680
TAATYL                                                                   1681 - 1686
//

Text Mined References (62)

PMID Year Title
26387957 2015 PI3K-C2? Knockdown Results in Rerouting of Insulin Signaling and Pancreatic Beta Cell Proliferation.
26175229 2015 Role of the microRNA, miR-206, and its target PIK3C2? in endothelial progenitor cell function – potential link with coronary artery disease.
25779105 2015 The class II PI 3-kinase, PI3KC2?, links platelet internal membrane structure to shear-dependent adhesive function.
25667265 2015 The class II phosphatidylinositol 3-phosphate kinase PIK3C2A promotes Shigella flexneri dissemination through formation of vacuole-like protrusions.
25614622 2015 Phosphatidylinositol 3-kinase class II ?-isoform PI3K-C2? is required for transforming growth factor ?-induced Smad signaling in endothelial cells.
25233418 2014 New insight into the intracellular roles of class II phosphoinositide 3-kinases.
24280982 2014 Polygenic dissection of diagnosis and clinical dimensions of bipolar disorder and schizophrenia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23320105 2013 Class II phosphoinositide 3-kinases contribute to endothelial cells morphogenesis.
23192342 2013 Essential role of class II phosphatidylinositol-3-kinase-C2? in sphingosine 1-phosphate receptor-1-mediated signaling and migration in endothelial cells.
More...