Property Summary

Ligand Count 1
NCBI Gene PubMed Count 53
PubMed Score 3128.97
PubTator Score 1137.53

Knowledge Summary

Patent (24,803)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Schizophrenia 1160 0.0 2.7

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.400 6.0e-07
astrocytic glioma 1.100 1.9e-02
atypical teratoid / rhabdoid tumor 2.100 8.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.197 9.8e-03
ependymoma 1.900 5.7e-03
glioblastoma 1.500 3.0e-02
group 4 medulloblastoma 1.200 4.1e-02
juvenile dermatomyositis 1.020 2.4e-07
medulloblastoma, large-cell 1.900 4.9e-07
osteosarcoma 2.798 1.6e-06
pancreatic cancer 1.100 8.5e-04
primary pancreatic ductal adenocarcinoma 1.127 2.4e-03
primitive neuroectodermal tumor 1.100 1.8e-03
progressive supranuclear palsy -1.500 7.7e-03
psoriasis 1.300 6.1e-04

Gene RIF (63)

AA Sequence

MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSSTRKKAQVYNK      1 - 70
QDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVTPILSPSFSAQLYFRPTIQRG     71 - 140
QWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFPSTEPIYLSLPGQSPYFSYPLTPATPFHPQG    141 - 210
SLPIYRPVVSTDMAKLFDKIASTSEFLKNGKARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPK    211 - 280
VDNVEVLDHEEEKNVSSLLAKDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQ    281 - 350
GHISQKDPNGTSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE    351 - 420
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEVLQNNHCLGSH    421 - 490
EHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKPCKEAMTRHPVEELLDSYHNQ    491 - 560
VELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESVKKLKRAVNLPRSKTADVTSLFGGEDTSRSS    561 - 630
TRGSLNPENPVQVSINQLTAAIYDLLRLHANSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNW    631 - 700
VSNYEKYYLICSLSHNGKDLFKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQ    701 - 770
SSGSSPDSNKQRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF    771 - 840
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRYYCFKHPNCLP    841 - 910
KILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAVTWIEAISDDELTDLLPQFVQ    911 - 980
ALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHDVQFSTRYEHVLGALLSVGGKRLREELLKQT    981 - 1050
KLVQLLGGVAEKVRQASGSARQVVLQRSMERVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLK   1051 - 1120
VTMVNADPMGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPAS   1121 - 1190
DTLRKIQVEYGVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS   1191 - 1260
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAYNLIRKQTNLF   1261 - 1330
LNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLGSIATKFNFFIHNLAQLRFSG   1331 - 1400
LPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDKHYIYVVRILREGQIEPSFVFRTFDEFQELH   1401 - 1470
NKLSIIFPLWKLPGFPNRMVLGRTHIKDVAAKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKA   1471 - 1540
EGIARSADAGSFSPTPGQIGGAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKR   1541 - 1610
KTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL   1611 - 1680
TAATYL                                                                   1681 - 1686
//

Text Mined References (67)

PMID Year Title