Property Summary

NCBI Gene PubMed Count 10
PubMed Score 99.99
PubTator Score 37.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
Alzheimer's disease -1.100 2.4e-02
dermatomyositis 1.400 2.1e-03
glioblastoma 1.200 4.0e-03
lung cancer 1.100 8.1e-04
Multiple myeloma 1.479 2.5e-03
ovarian cancer 2.600 1.8e-05
Pick disease -1.400 3.8e-04
tuberculosis and treatment for 6 months 1.100 1.9e-03

Gene RIF (1)

AA Sequence

MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGA      1 - 70
EIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTVMVF     71 - 140
KPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIYGRAFVAGVLPFKVAKDM    141 - 210
AAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEM    211 - 280
LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKD    281 - 350
TYIIECQGIGMTNPNL                                                          351 - 366
//

Text Mined References (12)

PMID Year Title