Property Summary

NCBI Gene PubMed Count 120
PubMed Score 157.00
PubTator Score 100.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Infant length 11
Peripheral Neuropathy 303
Disease Target Count P-value
non-small cell lung cancer 2798 1.76567830078161E-21
posterior fossa group A ependymoma 1511 1.49281138890973E-8
medulloblastoma, large-cell 6234 1.47863021292814E-7
pediatric high grade glioma 2712 1.16130708155827E-6
pancreatic cancer 2300 8.39070542771723E-6
group 3 medulloblastoma 2254 1.37620849298193E-5
osteosarcoma 7933 2.96916183133196E-5
astrocytoma 1493 8.42073449575154E-5
tuberculosis 1563 8.7454447598218E-5
glioblastoma 5572 1.0362458693927E-4
atypical teratoid / rhabdoid tumor 4369 1.65600985872437E-4
pancreatic carcinoma 567 2.49009485351539E-4
lung adenocarcinoma 2714 2.7390128490027E-4
oligodendroglioma 2849 7.76861752174635E-4
gastric cancer 436 0.00112462049773694
ovarian cancer 8492 0.00141523311296281
cutaneous lupus erythematosus 1056 0.00238769304509982
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00461157533797129
primitive neuroectodermal tumor 3031 0.005072312606403
pilocytic astrocytoma 3086 0.0137297708642096
nasopharyngeal carcinoma 1056 0.0160228860837921
lung cancer 4473 0.0263358635317926
colon cancer 1475 0.0319594472681047
Rheumatoid Arthritis 1171 0.0356373720416325
esophageal adenocarcinoma 737 0.0412786087226667
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.699 1.8

Expression

Synonym

Accession O00425 A0A4Z5 Q63HM0 Q6MZZ2 Q86VB1 IGF2 mRNA-binding protein 3
Symbols KOC
CT98
IMP3
KOC1
IMP-3
VICKZ3

Gene

PDB

2E44  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (99)

PMID Text
26974154 IGF2BP3 regulated transcripts via targeting elements within 3' untranslated regions (3'UTR)
26510428 MicroRNA-129-1 acts as tumour suppressor and induces cell cycle arrest of GBM cancer cells through targeting IGF2BP3 and MAPK1
26327240 An isocorydine derivative (d-ICD) inhibits drug resistance by downregulating IGF2BP3 expression in hepatocellular carcinoma.
26160756 Data show that insulin-like growth factor-2-mRNA-binding proteins IGF2BP1, IGF2BP2, and IGF2BP3 are direct targets of microRNA-1275 (miR-1275).
25499221 Our results provide insight into the link between regulation of KIF20A-mediated trafficking of IGF2BP3-containing stress granules and modulation of the motility and invasiveness in pancreatic cancers.
25216519 IGF2BP3 and IGF2BP3-bound transcripts are localized in cytoplasmic RNA granules that accumulate in membrane protrusions of pancreatic cancer cells.
25176620 these findings suggest that IMP3 expression may be a prognostic indicator of squamous cell carcinoma.
25010285 Tandem affinity purification and mass spectrometry analysis identify insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
24457969 IGF2BP3 was highly expressed in placental villi during early pregnancy, especially in cytotrophoblast cells and trophoblast column.
24411949 Our results suggest that IMP3 may be an ancillary tool in identifying aggressive abdominal mesenchymal tumors other than gastrointestinal stromal tumor.
More...

AA Sequence

MNKLYIGNLSENAAPSDLESIFKDAKIPVSGPFLVKTGYAFVDCPDESWALKAIEALSGKIELHGKPIEV      1 - 70
EHSVPKRQRIRKLQIRNIPPHLQWEVLDSLLVQYGVVESCEQVNTDSETAVVNVTYSSKDQARQALDKLN     71 - 140
GFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAI    141 - 210
IGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLK    211 - 280
ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRES    281 - 350
YENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAI    351 - 420
IGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEA    421 - 490
HIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQV    491 - 560
KQHQQQKALQSGPPQSRRK                                                       561 - 579
//

Text Mined References (130)

PMID Year Title
26974154 2016 RNA-binding protein IGF2BP3 targeting of oncogenic transcripts promotes hematopoietic progenitor proliferation.
26510428 2016 MicroRNA-129-1 acts as tumour suppressor and induces cell cycle arrest of GBM cancer cells through targeting IGF2BP3 and MAPK1.
26327240 2015 An isocorydine derivative (d-ICD) inhibits drug resistance by downregulating IGF2BP3 expression in hepatocellular carcinoma.
26160756 2015 miR-1275: A single microRNA that targets the three IGF2-mRNA-binding proteins hindering tumor growth in hepatocellular carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25499221 2014 KIF20A-mediated RNA granule transport system promotes the invasiveness of pancreatic cancer cells.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25216519 2014 IGF2BP3-mediated translation in cell protrusions promotes cell invasiveness and metastasis of pancreatic cancer.
25176620 2014 IMP3 expression is associated with poor survival in cervical squamous cell carcinoma.
More...