Property Summary

NCBI Gene PubMed Count 22
PubMed Score 14.59
PubTator Score 9.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 6.6e-04
atypical teratoid / rhabdoid tumor -1.100 1.1e-04
dermatomyositis 1.400 1.8e-03
glioblastoma -1.100 8.6e-03
invasive ductal carcinoma -1.200 1.7e-02
lung adenocarcinoma -1.100 7.3e-07
lung cancer -1.200 2.0e-03
medulloblastoma, large-cell -1.500 2.0e-04
Multiple myeloma 1.155 8.9e-04
non primary Sjogren syndrome sicca 1.100 4.3e-02
non-small cell lung cancer -1.364 1.2e-22
osteosarcoma -1.753 1.7e-03
ovarian cancer -1.700 2.7e-04
psoriasis -1.300 1.6e-07

Gene RIF (8)

AA Sequence

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT      1 - 70
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP     71 - 140
NRAPPPSGRMRPY                                                             141 - 153
//

Text Mined References (29)

PMID Year Title