Property Summary

NCBI Gene PubMed Count 21
Grant Count 8
R01 Count 5
Funding $556,013.04
PubMed Score 14.27
PubTator Score 9.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.155 0.001
psoriasis -1.500 0.002
osteosarcoma -1.753 0.002
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.100 0.009
medulloblastoma, large-cell -1.500 0.000
non-small cell lung cancer -1.364 0.000
lung cancer -1.400 0.000
adult high grade glioma -1.200 0.001
non primary Sjogren syndrome sicca 1.100 0.043
lung adenocarcinoma -1.100 0.000
invasive ductal carcinoma -1.200 0.017
ovarian cancer -1.700 0.000
dermatomyositis 1.400 0.002

Gene RIF (7)

PMID Text
25921304 These studies indicated that SAP18 expression enhanced the recruitment of mSin3A in coordination with TRIB1 to MTTP regulatory elements and increased MTTP expression.
25416801 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
23799881 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
20966198 A novel function of SAP18 in splicing regulation.
19503603 study indicates HIV-1 integrase & INI1/hSNF5 bind SAP18 & recruit components of Sin3a-HDAC1 complex into HIV-1 virions; HIV-1 virion-associated HDAC1 is required for efficient early post-entry events, indicating novel role for HDAC1 in HIV-1 replication
19503603 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
19454010 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells

AA Sequence

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT      1 - 70
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP     71 - 140
NRAPPPSGRMRPY                                                             141 - 153
//

Text Mined References (27)

PMID Year Title
25921304 2015 Sin3A-associated protein, 18 kDa, a novel binding partner of TRIB1, regulates MTTP expression.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22203037 2012 Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
21269460 2011 Initial characterization of the human central proteome.
20966198 2010 Human SAP18 mediates assembly of a splicing regulatory multiprotein complex via its ubiquitin-like fold.
More...