Property Summary

NCBI Gene PubMed Count 18
Grant Count 67
R01 Count 46
Funding $16,470,707.21
PubMed Score 15.14
PubTator Score 100.50

Knowledge Summary

Patent (50,713)

Expression

Synonym

Accession O00421 B4DKQ8 O75307 Q4VBB0 Q6IPX0 Q7KYQ9 Q96KP5 Q9UPG0
Symbols HCR
CKRX
CRAM
ACKR5
CRAM-A
CRAM-B

Gene

  TechDev Info (1)

Gene RIF (10)

PMID Text
26563945 in breast cancer, CRAM-A becomes specifically upregulated under inflammatory stimuli and may serve as a potential marker of immune response.
26487662 CCRL2 inhibited the growth of breast cancer cells in vitro and in vivo.
24162774 HIV-1 gp120 upregulates the expression of chemokine (C-C motif) receptor-like 2 (CCRL2) in human B cells
23142225 these results suggest for the first time that elevated CCRL2 in glioma promotes cell migration and invasion.
22046140 Considering the newly defined role of CCRL2 in lung dendritic cell trafficking, this atypical chemokine receptor may affect pneumocystis pneumonia through immune regulation and inducing inflammation.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20002784 demonstration that the homeostatic chemokine CCL19 is a specific ligand for CRAM
18794339 Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2.
15188357 CCRL2 expression is up-regulated on synovial neutrophils of rheumatoid arthritis patients

AA Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLK      1 - 70
RVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFS     71 - 140
ARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLV    141 - 210
LPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDK    211 - 280
SVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV          281 - 344
//

Text Mined References (21)

PMID Year Title
26563945 2015 CRAM-A indicates IFN-?-associated inflammatory response in breast cancer.
26487662 2015 The human chemokine receptor CCRL2 suppresses chemotaxis and invasion by blocking CCL2-induced phosphorylation of p38 MAPK in human breast cancer cells.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
23142225 2012 Elevated chemokine CC-motif receptor-like 2 (CCRL2) promotes cell migration and invasion in glioblastoma.
22046140 2011 Role of exonic variation in chemokine receptor genes on AIDS: CCRL2 F167Y association with pneumocystis pneumonia.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20002784 2010 CCL19 is a specific ligand of the constitutively recycling atypical human chemokine receptor CRAM-B.
More...