Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.14
PubTator Score 100.50

Knowledge Summary

Patent (50,713)

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.800 4.2e-07
cutaneous lupus erythematosus 2.600 1.4e-04
osteosarcoma -3.257 3.5e-05
tuberculosis -4.000 1.2e-08
non-small cell lung cancer -1.883 5.3e-18
intraductal papillary-mucinous adenoma (... 1.500 1.4e-03
intraductal papillary-mucinous carcinoma... 1.400 3.5e-03
lung cancer -2.400 1.1e-02
lung adenocarcinoma -1.203 9.3e-07
lung carcinoma -1.700 3.0e-19
mucosa-associated lymphoid tissue lympho... 1.086 1.9e-02

Gene RIF (10)

PMID Text
26563945 in breast cancer, CRAM-A becomes specifically upregulated under inflammatory stimuli and may serve as a potential marker of immune response.
26487662 CCRL2 inhibited the growth of breast cancer cells in vitro and in vivo.
24162774 HIV-1 gp120 upregulates the expression of chemokine (C-C motif) receptor-like 2 (CCRL2) in human B cells
23142225 these results suggest for the first time that elevated CCRL2 in glioma promotes cell migration and invasion.
22046140 Considering the newly defined role of CCRL2 in lung dendritic cell trafficking, this atypical chemokine receptor may affect pneumocystis pneumonia through immune regulation and inducing inflammation.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20002784 demonstration that the homeostatic chemokine CCL19 is a specific ligand for CRAM
18794339 Results identify chemerin as a natural nonsignaling protein ligand for both human and mouse CCRL2.
15188357 CCRL2 expression is up-regulated on synovial neutrophils of rheumatoid arthritis patients

AA Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLK      1 - 70
RVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFS     71 - 140
ARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLV    141 - 210
LPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDK    211 - 280
SVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV          281 - 344
//

Text Mined References (21)

PMID Year Title
26563945 2015 CRAM-A indicates IFN-?-associated inflammatory response in breast cancer.
26487662 2015 The human chemokine receptor CCRL2 suppresses chemotaxis and invasion by blocking CCL2-induced phosphorylation of p38 MAPK in human breast cancer cells.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
23142225 2012 Elevated chemokine CC-motif receptor-like 2 (CCRL2) promotes cell migration and invasion in glioblastoma.
22046140 2011 Role of exonic variation in chemokine receptor genes on AIDS: CCRL2 F167Y association with pneumocystis pneumonia.
21502085 2011 Genome-wide association study implicates PARD3B-based AIDS restriction.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20002784 2010 CCL19 is a specific ligand of the constitutively recycling atypical human chemokine receptor CRAM-B.
18794339 2008 Mast cell-expressed orphan receptor CCRL2 binds chemerin and is required for optimal induction of IgE-mediated passive cutaneous anaphylaxis.
18397265 2008 Human B cells express the orphan chemokine receptor CRAM-A/B in a maturation-stage-dependent and CCL5-modulated manner.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188357 2004 Up-regulated expression and activation of the orphan chemokine receptor, CCRL2, in rheumatoid arthritis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14530373 2003 Specific recruitment of antigen-presenting cells by chemerin, a novel processed ligand from human inflammatory fluids.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11828366 2002 Distribution and regulation of expression of the putative human chemokine receptor HCR in leukocyte populations.
9473515 1998 Cloning and characterization of a novel human chemokine receptor.
9143512 1997 The beta-chemokine receptor genes CCR1 (CMKBR1), CCR2 (CMKBR2), and CCR3 (CMKBR3) cluster within 285 kb on human chromosome 3p21.