Property Summary

NCBI Gene PubMed Count 48
Grant Count 29
R01 Count 5
Funding $2,077,705.15
PubMed Score 16.85
PubTator Score 86.90

Knowledge Summary

Patent (4,179)

Expression

  Differential Expression (8)

Disease log2 FC p
non-small cell lung cancer -1.065 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.018
diabetes mellitus -1.100 0.004
group 3 medulloblastoma 1.200 0.001
psoriasis -1.300 0.000
invasive ductal carcinoma -1.800 0.001
ulcerative colitis -1.400 0.000
ovarian cancer 1.700 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (32)

PMID Text
26009171 Recent evidence shows that eEF2K plays an important role in learning and memory, processes that require the synthesis of new proteins and involve Ca-mediated signalling. eEF2K is activated under conditions of nutrient and energy depletion
25776553 Results show that eEF2K is rapidly activated in response to acidosis in cells, an effect that is followed by its downregulation.
25755286 Data show that eEF2K is activated during hypoxia or upon inhibition of prolyl hydroxylases and inhibited by its hydroxylation on a highly conserved proline residue, restricting its activity during normoxia.
25670349 data suggest that achieving an active conformation, rather than eEF2K activity per se, is required for its susceptibility to degradation.
25353634 data show that the major trigger for activation of eEF2K upon mild cooling is the release of Ca2+ ions from the endoplasmic reticulum (ER)
25330770 Deletion of Pten and p53 in mammary epithelium accelerates triple-negative breast cancer with dependency on eEF2K activity.
25215932 our results show, for the first time, that eEF-2K is involved in regulation of the invasive phenotype of PaCa cells through promoting a new signalling pathway, which is mediated by TG2/b1 integrin/Src/uPAR/MMP-2
25182533 mTORC1 pathway and the oncogenic Ras/Raf/MEK/extracellular signal-regulated kinase (ERK) pathway cooperate to restrict eEF2K activity.
25012662 eEF-2K activation appears to be analogous to an amplifier, where output volume may be controlled by either toggling the power switch or altering the volume control
24955726 silencing of EEF2K promotes autophagic survival via activation of the AMPK-ULK1 pathway in colon cancer cells
More...

AA Sequence

MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYYSNLTKSERYS      1 - 70
SSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAVTGEWLDDEVLIKMASQPFGR     71 - 140
GAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIM    141 - 210
QMCIIELKDRPGKPLFHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGD    211 - 280
LYTDPQIHTETGTDFGDGNLGVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTIL    281 - 350
RGTEEKCGSPQVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN    351 - 420
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGRVCVEKWNLLN    421 - 490
SSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFCEKGEEWDQESAVFHLEHAAN    491 - 560
LGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDYLLKAAEAGDRQSMILVARAFDSGQNLSPDR    561 - 630
CQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAA    631 - 700
MEAMKGRLANQYYQKAEEAWAQMEE                                                 701 - 725
//

Text Mined References (61)

PMID Year Title
26009171 2015 Regulation and roles of elongation factor 2 kinase.
25776553 2015 Molecular Mechanism for the Control of Eukaryotic Elongation Factor 2 Kinase by pH: Role in Cancer Cell Survival.
25755286 2015 Elongation Factor 2 Kinase Is Regulated by Proline Hydroxylation and Protects Cells during Hypoxia.
25670349 2015 Regulated stability of eukaryotic elongation factor 2 kinase requires intrinsic but not ongoing activity.
25353634 2015 Eukaryotic elongation factor 2 kinase regulates the cold stress response by slowing translation elongation.
25330770 2014 Combined deletion of Pten and p53 in mammary epithelium accelerates triple-negative breast cancer with dependency on eEF2K.
25215932 2014 Elongation factor-2 kinase regulates TG2/?1 integrin/Src/uPAR pathway and epithelial-mesenchymal transition mediating pancreatic cancer cells invasion.
25182533 2014 Eukaryotic elongation factor 2 kinase activity is controlled by multiple inputs from oncogenic signaling.
25012662 2014 The molecular mechanism of eukaryotic elongation factor 2 kinase activation.
24955726 2014 Silencing of EEF2K (eukaryotic elongation factor-2 kinase) reveals AMPK-ULK1-dependent autophagy in colon cancer cells.
More...