Property Summary

NCBI Gene PubMed Count 28
Grant Count 20
R01 Count 16
Funding $1,749,450.66
PubMed Score 48.37
PubTator Score 33.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.038 0.006
ovarian cancer 1.700 0.000

Gene RIF (18)

PMID Text
26586915 knock-down of MRPL12 by RNA interference results in instability of POLRMT.
26484416 Suggest targeting POLRMT as strategy for treating acute myeloid leukemia.
26403317 Results show that polymorphisms at POLG2 and POLRMT increased risk of oral cancer and leukoplakia, respectively, probably modulating synthesis and activity of the enzymes.
24413562 The results reveal the organization of TFAM, POLRMT and TFB2M around the light-strand promoter and represent the first structural characterization of the entire mitochondrial transcriptional initiation complex.
24393772 The results demonstrate that human TFAM binds to the N-terminal domain of mtRNAP, which results in bending of the promoter DNA around mtRNAP.
24096365 Newly synthesized RNA exits toward the pentatricopeptide repeat (PPR) domain, a unique feature of mtRNAP with conserved RNA-recognition motifs.
23303773 Authors propose that POLRMT interacts directly with h-mtTFB1 in 28S mitochondrial ribosomes to augment its 12S rRNA methyltransferase activity.
21947009 X-ray structure of human mtRNAP at 2.5 A resolution, which reveals a T7-like catalytic carboxy-terminal domain, an amino-terminal domain resembling the T7 promoter-binding domain, a novel pentatricopeptide repeat domain, and flexible N-terminal extension
21799907 muscle actin genes are transcribed by nuclear isoform of mitochondrial RNA polymerase (spRNAP-IV) whereas the non-muscle actin genes are transcribed by the conventional RNA polymerase II (PolII)
21548588 Human mitochondrial RNA polymerase: evaluation of the single-nucleotide-addition cycle on synthetic RNA/DNA scaffolds
More...

AA Sequence

MSALCWGRGAAGLKRALRPCGRPGLPGKEGTAGGVCGPRRSSSASPQEQDQDRRKDWGHVELLEVLQARV      1 - 70
RQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRL     71 - 140
KAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAP    141 - 210
SGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKEL    211 - 280
VYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKA    281 - 350
VHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSVEKP    351 - 420
TLPSKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYEGRFSLYPFLCLLDEREVVRMLLQVLQAL    421 - 490
PAQGESFTTLARELSARTFSRHVVQRQRVSGQVQALQNHYRKYLCLLASDAEVPEPCLPRQYWEELGAPE    491 - 560
ALREQPWPLPVQMELGKLLAEMLVQATQMPCSLDKPHRSSRLVPVLYHVYSFRNVQQIGILKPHPAYVQL    561 - 630
LEKAAEPTLTFEAVDVPMLCPPLPWTSPHSGAFLLSPTKLMRTVEGATQHQELLETCPPTALHGALDALT    631 - 700
QLGNCAWRVNGRVLDLVLQLFQAKGCPQLGVPAPPSEAPQPPEAHLPHSAAPARKAELRRELAHCQKVAR    701 - 770
EMHSLRAEALYRLSLAQHLRDRVFWLPHNMDFRGRTYPCPPHFNHLGSDVARALLEFAQGRPLGPHGLDW    771 - 840
LKIHLVNLTGLKKREPLRKRLAFAEEVMDDILDSADQPLTGRKWWMGAEEPWQTLACCMEVANAVRASDP    841 - 910
AAYVSHLPVHQDGSCNGLQHYAALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQV    911 - 980
LEGFITRKVVKQTVMTVVYGVTRYGGRLQIEKRLRELSDFPQEFVWEASHYLVRQVFKSLQEMFSGTRAI    981 - 1050
QHWLTESARLISHMGSVVEWVTPLGVPVIQPYRLDSKVKQIGGGIQSITYTHNGDISRKPNTRKQKNGFP   1051 - 1120
PNFIHSLDSSHMMLTALHCYRKGLTFVSVHDCYWTHAADVSVMNQVCREQFVRLHSEPILQDLSRFLVKR   1121 - 1190
FCSEPQKILEASQLKETLQAVPKPGAFDLEQVKRSTYFFS                                 1191 - 1230
//

Text Mined References (30)

PMID Year Title
26586915 2016 Mitochondrial Ribosomal Protein L12 Is Required for POLRMT Stability and Exists as Two Forms Generated by Alternative Proteolysis during Import.
26484416 2015 Targeting mitochondrial RNA polymerase in acute myeloid leukemia.
26403317 2016 Association of DNA sequence variation in mitochondrial DNA polymerase with mitochondrial DNA synthesis and risk of oral cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24413562 2014 Organization of the human mitochondrial transcription initiation complex.
24393772 2014 A novel intermediate in transcription initiation by human mitochondrial RNA polymerase.
24096365 2013 Structure of human mitochondrial RNA polymerase elongation complex.
23303773 2013 Transcription-independent role for human mitochondrial RNA polymerase in mitochondrial ribosome biogenesis.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...