Property Summary

NCBI Gene PubMed Count 64
Grant Count 5
R01 Count 3
Funding $258,457
PubMed Score 147.92
PubTator Score 46.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
interstitial lung disease -1.400 0.020
Waldenstrons macroglobulinemia 1.138 0.012
Multiple myeloma 1.038 0.009
astrocytic glioma -1.800 0.017
ependymoma -1.400 0.030
oligodendroglioma -1.300 0.035
sonic hedgehog group medulloblastoma 1.600 0.000
glioblastoma -1.800 0.000
medulloblastoma, large-cell 1.600 0.000
hereditary spastic paraplegia -1.084 0.012
primary pancreatic ductal adenocarcinoma -1.120 0.018
colon cancer 1.200 0.047
lung cancer 1.800 0.001
pediatric high grade glioma -1.200 0.000
invasive ductal carcinoma -1.140 0.001
nasopharyngeal carcinoma 1.200 0.001
ovarian cancer -2.100 0.000

Synonym

Accession O00410 B4DZA0 O15257 Q5T578 Q86XC7 Imp5
Symbols IMB3
Pse1
imp5
KPNB3
RANBP5

Gene

Gene RIF (57)

PMID Text
26488411 Single nucleotide polymorphism in IPO5 gene is associated with Peripheral Arterial Disease.
25505242 The interaction of HIV-1 CA with human cellular importin 5 protein (IPO5) is identified by yeast two-hybrid screen
24196961 IQGAP1 interacts with human importin-beta5 in HEK 293T cells.
23266416 In case of L7, importin beta2 or importin beta3 are preferentially used by clusters with a high import efficiency.
22509482 The interaction of HIV-1 CA with human cellular importin 5 protein (IPO5) is identified by yeast two-hybrid screen
21562121 The N-terminal of influenza A virus PB1 mediates its binding to host RanBP5.
21326825 The interaction of HIV-1 CA with human cellular importin 5 protein (IPO5) is identified by yeast two-hybrid screen
20828572 importin beta3 is essential for the nuclear import of RPL7. The import is mediated via the multifaceted basic amino acid clusters present in the NH(2)-region of RPL7, and is RanGTP-dependent
20542336 The results of this study suggested that abnormal expression and alternative splicing of the IPO5 gene may be involved in the pathophysiology of schizophrenia.
20542336 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTTAAEEARQMAAVLLRRLL      1 - 70
SSAFDEVYPALPSDVQTAIKSELLMIIQMETQSSMRKKVCDIAAELARNLIDEDGNNQWPEGLKFLFDSV     71 - 140
SSQNVGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVAL    141 - 210
FKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTSLNNMQRQLAL    211 - 280
EVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGL    281 - 350
GGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAAC    351 - 420
NAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDNLVKHLH    421 - 490
SIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIEC    491 - 560
ISLIGLAVGKEKFMQDASDVMQLLLKTQTDFNDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPL    561 - 630
MKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYT    631 - 700
EQVVKLMVPLLKFYFHDGVRVAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIM    701 - 770
HSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILT    771 - 840
KVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPM    841 - 910
LQYVCDNSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADSKTKENVNATENCISAVGKIM    911 - 980
KFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEA    981 - 1050
IKHEDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA                          1051 - 1097
//

Text Mined References (76)

PMID Year Title
26488411 2015 Genome-Wide Association Study of Peripheral Arterial Disease in a Japanese Population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24196961 2013 IQGAP1 protein regulates nuclear localization of ?-catenin via importin-?5 protein in Wnt signaling.
23541588 2013 Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
23266416 2013 The quantitative assessment of the role played by basic amino acid clusters in the nuclear uptake of human ribosomal protein L7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22730302 2012 NMDAR signaling facilitates the IPO5-mediated nuclear import of CPEB3.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...