Property Summary

NCBI Gene PubMed Count 25
Grant Count 7
R01 Count 3
Funding $1,437,763.64
PubMed Score 19.87
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.419 0.003
Multiple myeloma -1.420 0.000
cutaneous lupus erythematosus -1.300 0.002
psoriasis -1.400 0.000
osteosarcoma 3.087 0.000
astrocytoma 1.600 0.001
atypical teratoid / rhabdoid tumor 1.100 0.002
medulloblastoma, large-cell 1.200 0.000
hereditary spastic paraplegia -1.244 0.014
pancreatic ductal adenocarcinoma liver m... -1.810 0.001
tuberculosis and treatment for 3 months 1.100 0.000
colon cancer -1.700 0.043
lung cancer -1.100 0.004
breast carcinoma -1.600 0.000
fibroadenoma -1.500 0.016
Pick disease 1.200 0.000
Breast cancer -1.500 0.000
ductal carcinoma in situ -1.600 0.000
invasive ductal carcinoma -2.100 0.001
ulcerative colitis -1.500 0.002
ovarian cancer -2.500 0.000
pancreatic cancer 1.100 0.048
head and neck cancer -1.100 0.000

Gene RIF (12)

PMID Text
26069251 Foxn3 is a direct transcriptional suppressor of N-cadherin in colorectal metastasis.
25210877 MEN1 patients with MEN1 mutations leading to CHES1-loss of interaction have a higher risk of malignant pancreatic neuroendocrine tumors with an aggressive course of disease and disease-related death.
24403608 CHES1 decreases protein synthesis and cell proliferation in tumor cell lines but not in normal fibroblasts.
23133627 MicroRNA-574-5p has a critical role in TLR9 signaling enhanced tumor progression via down-regulating checkpoint suppressor 1
20691664 the Foxn3 mutation leads to partial embryonic and postnatal lethality, growth retardation, eye formation defects, dental anomalies and craniofacial defects.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19609547 Four genes previously not examined in that respect in laryngeal carcinoma, occurred to be good markers of the neoplasm. They are: metal-proteinase ADAM12, cyclin-dependent kinase 2-CDK2, kinesin 14-KIF14, suppressor 1 of checkpoint-CHES1.
18074379 FOXN3 might contribute to the observed phenotype.
17983802 Two novel homozygously deleted genes in hepatocellular carcinomas are caspase 3 and CHES1.
More...

AA Sequence

MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELTNLNWLHESK      1 - 70
NLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFSCLIFMAIEDSPTKRLPVKDI     71 - 140
YNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQALKKTPYHP    141 - 210
HPHVFNTPPTCPQAYQSTSGPPIWPGSTFFKRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGA    211 - 280
RVLSRGLFPGVRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSP    281 - 350
TSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK    351 - 420
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN    421 - 490
//

Text Mined References (27)

PMID Year Title
26069251 2015 A Systematic Approach to Defining the microRNA Landscape in Metastasis.
25210877 2014 Higher risk of aggressive pancreatic neuroendocrine tumors in MEN1 patients with MEN1 mutations affecting the CHES1 interacting MENIN domain.
24403608 2014 CHES1/FOXN3 regulates cell proliferation by repressing PIM2 and protein biosynthesis.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
23133627 2012 MicroRNA-574-5p was pivotal for TLR9 signaling enhanced tumor progression via down-regulating checkpoint suppressor 1 in human lung cancer.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20691664 2010 Foxn3 is essential for craniofacial development in mice and a putative candidate involved in human congenital craniofacial defects.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...