Property Summary

NCBI Gene PubMed Count 28
PubMed Score 20.37
PubTator Score 16.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytoma 1.600 1.1e-03
atypical teratoid / rhabdoid tumor 1.100 1.8e-03
Breast cancer -1.500 2.5e-09
breast carcinoma -1.600 1.4e-05
colon cancer -1.700 4.3e-02
cutaneous lupus erythematosus -1.300 2.2e-03
ductal carcinoma in situ -1.200 2.0e-04
fibroadenoma -1.400 3.8e-03
head and neck cancer -1.100 1.2e-04
hereditary spastic paraplegia -1.244 1.4e-02
invasive ductal carcinoma -1.900 2.0e-04
lung cancer -1.100 4.1e-03
medulloblastoma, large-cell 1.200 4.7e-05
Multiple myeloma -1.420 4.6e-04
osteosarcoma 3.087 1.4e-08
ovarian cancer 2.300 2.1e-10
pancreatic cancer 1.100 4.8e-02
pancreatic ductal adenocarcinoma liver m... -1.810 7.4e-04
Pick disease 1.200 6.1e-06
psoriasis -1.400 1.4e-04
tuberculosis and treatment for 3 months 1.100 2.8e-05
ulcerative colitis -1.500 1.9e-03
Waldenstrons macroglobulinemia -1.419 2.9e-03

Protein-protein Interaction (7)

Gene RIF (15)

AA Sequence

MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELTNLNWLHESK      1 - 70
NLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFSCLIFMAIEDSPTKRLPVKDI     71 - 140
YNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQALKKTPYHP    141 - 210
HPHVFNTPPTCPQAYQSTSGPPIWPGSTFFKRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGA    211 - 280
RVLSRGLFPGVRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSP    281 - 350
TSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK    351 - 420
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN    421 - 490
//

Text Mined References (30)

PMID Year Title