Property Summary

NCBI Gene PubMed Count 34
Grant Count 12
R01 Count 5
Funding $930,729.29
PubMed Score 58.10
PubTator Score 41.35

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

 GWAS Trait (1)

Gene RIF (18)

PMID Text
26095046 Epigenetic regulation of phosphodiesterases 2A and 3A underlies compromised beta-adrenergic Signaling in an induced pluripotent stem cell model of dilated cardiomyopathy.
25941078 Lu AF33241 represents a novel PDE2A/PDE10A inhibitor tool which can penetrate the blood brain barrier.
25230992 curcumin exerts its in vitro anti-angiogenic and in vivo anti-tumour properties through combined PDE2 and PDE4 inhibition
24705027 PDE2A is involved in growth and invasion of human malignant melanoma PMP cells.
23899287 This study reports the X-ray crystal structure of PDE2A in complex with a highly selective, nanomolar inhibitor (BAY60-7550) at 1.9 A resolution, and the structure of apo PDE2 at 2.0 A resolution.
23810893 PDE2 overexpression in healthy cardiomyocytes reduces the rise in cyclic AMP levels and L-type calcium current amplitude, and abolishes the inotropic effect following acute beta-adrenergic receptor stimulation.
23381931 Our results demonstrated that the PDE2A2 variant carrying point mutations is expressed in PMP cells and may affect cell cycle progression by modulating cyclin A expression.
21766240 Active site similarity between human and Plasmodium falciparum phosphodiesterases: considerations for antimalarial drug design
21724846 the phosphodiesterase 2A isoform localized to mitochondria regulates respiration
21697861 found in smooth muscle wall of blood vessels transversing the clitoral supepithelial and stromal space
More...

AA Sequence

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPPPQPCADSLQDALLSLGSVIDISGLQRAVKEA      1 - 70
LSAVLPRVETVYTYLLDGESQLVCEDPPHELPQEGKVREAIISQKRLGCNGLGFSDLPGKPLARLVAPLA     71 - 140
PDTQVLVMPLADKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVALRRVQVLQQRGPREAPRAVQNPP    141 - 210
EGTAEDQKGGAAYTDRDRKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIG    211 - 280
DKVLGEEVSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAF    281 - 350
NKLEGDLFTDEDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITE    351 - 420
ARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRG    421 - 490
VDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEA    491 - 560
QYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFIN    561 - 630
NYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDH    631 - 700
RGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDL    701 - 770
AHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAM    771 - 840
GNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSN    841 - 910
NSLDFLDEEYEVPDLDGTRAPINGCCSLDAE                                           911 - 941
//

Text Mined References (38)

PMID Year Title
26095046 2015 Epigenetic Regulation of Phosphodiesterases 2A and 3A Underlies Compromised ?-Adrenergic Signaling in an iPSC Model of Dilated Cardiomyopathy.
25941078 2015 Characterisation of Lu AF33241: A novel, brain-penetrant, dual inhibitor of phosphodiesterase (PDE) 2A and PDE10A.
25230992 2015 Tumour growth inhibition and anti-angiogenic effects using curcumin correspond to combined PDE2 and PDE4 inhibition.
24705027 2014 Role of phosphodiesterase 2 in growth and invasion of human malignant melanoma cells.
23899287 2013 X-ray crystal structure of phosphodiesterase 2 in complex with a highly selective, nanomolar inhibitor reveals a binding-induced pocket important for selectivity.
23810893 2013 Phosphodiesterase-2 is up-regulated in human failing hearts and blunts ?-adrenergic responses in cardiomyocytes.
23381931 2013 Characterization of phosphodiesterase 2A in human malignant melanoma PMP cells.
22446963 2012 Meta-analysis identifies nine new loci associated with rheumatoid arthritis in the Japanese population.
21766240 2011 Active site similarity between human and Plasmodium falciparum phosphodiesterases: considerations for antimalarial drug design.
21724846 2011 A phosphodiesterase 2A isoform localized to mitochondria regulates respiration.
More...