Property Summary

NCBI Gene PubMed Count 106
Grant Count 256
R01 Count 153
Funding $24,429,883.97
PubMed Score 243.61
PubTator Score 180.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.001
astrocytic glioma 1.100 0.014
psoriasis 1.100 0.002
osteosarcoma 2.017 0.000
periodontitis -1.100 0.000
atypical teratoid / rhabdoid tumor -1.300 0.006
medulloblastoma -1.100 0.017
medulloblastoma, large-cell -2.000 0.002
adrenocortical carcinoma 1.148 0.001
colon cancer -1.100 0.002
Breast cancer 2.300 0.028
spina bifida -1.663 0.036
ovarian cancer 3.300 0.000

Synonym

Accession O00401 A1JUI9 Q7Z746 N-WASP
Symbols NWASP
WASPB
N-WASP

Gene

PDB

2LNH   2FF3   2VCP   4CC2   4CC7  

 GO Function (1)

 GWAS Trait (1)

Gene RIF (47)

PMID Text
26986510 the Cdc42/Nwasp/stress fibers/YAP signal pathway may potentially play an important role in regulating podocyte apoptosis. Maintaining necessary Cdc42 would be one potent way to prevent proteinuria kidney diseases.
26554011 Nck was the most potent activator of N-WASP-driven actin assembly.
26506240 Low GAS7C increases cancer cell motility by promoting N-WASP/FAK/F-actin cytoskeleton dynamics. It also enhances beta-catenin stability via hnRNP U/beta-TrCP complex formation.
26463123 This suggests that N-WASP's failure to compensate for WASP in rescuing chemotaxis could be due to the absence of this I30 region.
26305187 RTVP-1 regulates glioma cell spreading, migration and invasion and that these effects are mediated via interaction with N-WASP and by interfering with the inhibitory effect of hnRNPK on the function of this protein.
26070569 our results reveal a novel role for N-WASP in remodeling EC junctions, which is critical for monolayer integrity and function.
25482634 Tir-Intimin interaction recruits the Nck adaptor to a Tir tyrosine phosphorylated residue where it activates neural Wiskott-Aldrich syndrome protein (N-WASP).
25262827 These results support a role for N-WASP in amphiphysin-2-dependent nuclear positioning and triad organization and in centronuclear myopathy and myotonic dystrophy pathophysiology.
24385601 PC1 modulates actin cytoskeleton rearrangements and directional cell migration through the Pacsin 2/N-Wasp complex.
24284073 Our observations suggest that ITSN1 is an important general regulator of Cdc42-, Nck- and N-WASP-dependent actin polymerisation
More...

AA Sequence

MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKKCSGVACLVKD      1 - 70
NPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGR     71 - 140
RQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISHTKEKKKGKAKKKRLTKADIGTPSNFQ    141 - 210
HIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPP    211 - 280
PPSRGGPPPPPPPPHNSGPPPPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPAL    281 - 350
PSSAPSGPPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTTAGNKAALLDQIREGAQLK    351 - 420
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRSKAIHSSDEDED    421 - 490
EDDEEDFEDDDEWED                                                           491 - 505
//

Text Mined References (120)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26986510 2016 Cdc42 deficiency induces podocyte apoptosis by inhibiting the Nwasp/stress fibers/YAP pathway.
26554011 2015 Allosteric N-WASP activation by an inter-SH3 domain linker in Nck.
26506240 2015 Growth-arrest-specific 7C protein inhibits tumor metastasis via the N-WASP/FAK/F-actin and hnRNP U/?-TrCP/?-catenin pathways in lung cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26463123 2015 Molecular difference between WASP and N-WASP critical for chemotaxis of T-cells towards SDF-1?.
26305187 2015 RTVP-1 regulates glioma cell migration and invasion via interaction with N-WASP and hnRNPK.
26070569 2015 Role of N-WASP in Endothelial Monolayer Formation and Integrity.
25482634 2014 Nck adaptors, besides promoting N-WASP mediated actin-nucleation activity at pedestals, influence the cellular levels of enteropathogenic Escherichia coli Tir effector.
25416956 2014 A proteome-scale map of the human interactome network.
More...