Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.47
PubTator Score 997.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 8.95393224614242E-7
lung adenocarcinoma 2714 3.31633992810612E-5
astrocytoma 1493 0.00204116998672707
Disease Target Count Z-score Confidence
Newcastle disease 13 5.447 2.7

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 0.002
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession O00399 B2RAC1
Symbols WS3
p27
WS-3

Gene

PDB

3TV0  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
23455152 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.

AA Sequence

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI      1 - 70
TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN     71 - 140
TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN                        141 - 190
//

Text Mined References (11)

PMID Year Title
23455152 2013 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15043994 2004 Dynactins p25 and p27 are predicted to adopt the LbetaH fold.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10525537 1999 Analysis of dynactin subcomplexes reveals a novel actin-related protein associated with the arp1 minifilament pointed end.
10318868 1999 Up-regulation of nuclear and mitochondrial genes in the skeletal muscle of mice lacking the heart/muscle isoform of the adenine nucleotide translocator.
More...