Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.53
PubTator Score 997.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 9.0e-07
lung adenocarcinoma 2716 3.3e-05
astrocytoma 1146 2.0e-03
Disease Target Count Z-score Confidence
Newcastle disease 14 5.452 2.7

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 2.0e-03
lung adenocarcinoma -1.100 3.3e-05
ovarian cancer -1.800 9.0e-07

Protein-protein Interaction (10)

Gene RIF (1)

AA Sequence

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI      1 - 70
TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN     71 - 140
TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN                        141 - 190
//

Text Mined References (13)

PMID Year Title