Property Summary

NCBI Gene PubMed Count 9
Grant Count 1,236
R01 Count 800
Funding $96,762,131.93
PubMed Score 0.47
PubTator Score 997.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.100 0.002
lung adenocarcinoma -1.100 0.000
ovarian cancer -1.800 0.000

Synonym

Accession O00399 B2RAC1
Symbols WS3
p27
WS-3

Gene

PDB

3TV0  

Gene RIF (1)

PMID Text
23455152 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.

AA Sequence

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI      1 - 70
TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN     71 - 140
TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN                        141 - 190
//

Text Mined References (11)

PMID Year Title
23455152 2013 Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15043994 2004 Dynactins p25 and p27 are predicted to adopt the LbetaH fold.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10525537 1999 Analysis of dynactin subcomplexes reveals a novel actin-related protein associated with the arp1 minifilament pointed end.
10318868 1999 Up-regulation of nuclear and mitochondrial genes in the skeletal muscle of mice lacking the heart/muscle isoform of the adenine nucleotide translocator.
More...