Property Summary

NCBI Gene PubMed Count 12
Grant Count 4
R01 Count 4
Funding $184,045.18
PubMed Score 2.26
PubTator Score 4.62

Knowledge Summary

Patent (5,046)

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.232 0.000
tuberculosis -1.400 0.000
interstitial cystitis 2.100 0.010
lung carcinoma -1.500 0.000
psoriasis 1.300 0.000

Synonym

Accession O00398 D3DTE5 Q4VBN7 Q86V16 P2Y10
Symbols P2Y10
LYPSR2

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (1)

PMID Text
18466763 The P2Y(10) receptor is the first receptor identified as a dual lysophospholipid receptor.

AA Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAI      1 - 70
IFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFR     71 - 140
ARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIP    141 - 210
VIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVV    211 - 280
RIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG               281 - 339
//

Text Mined References (12)

PMID Year Title
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18466763 2008 Identification of the orphan GPCR, P2Y(10) receptor as the sphingosine-1-phosphate and lysophosphatidic acid receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11004484 2000 Expression of purinergic receptors (ionotropic P2X1-7 and metabotropic P2Y1-11) during myeloid differentiation of HL60 cells.
More...