Property Summary

NCBI Gene PubMed Count 42
Grant Count 8
R01 Count 8
Funding $676,887
PubMed Score 34.96
PubTator Score 47.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26158899 Data indicate ebselen as an in vitro inhibitor of quiescin sulfhydryl oxidase 1 (QSOX1) enzymatic activity.
25908093 QSOX1 immunoexpression was observed in the non-neoplastic cerebellum samples and the medulloblastoma samples
24704990 QSOX1 may be involved in neuroblastoma differentiation and regression and may thus function as a biomarker for identifying risk groups for this neoplasm.
24468475 Examination of the unusual kinetics of QSOX1 toward cysteine and glutathione at low micromolar concentrations suggests that circulating QSOX1 is unlikely to significantly contribute to the oxidation of these monothiols in plasma
24359107 QSOX1 may be revealed as an important player in cancer detection and prognosis. Defining the mechanism(s) of QSOX1 activity in tumors and in in vivo models will provide important insights into how to target QSOX1 with anti-neoplastic agents.
24008827 QSOX1 is induced by hypoxic stimuli and identified that QSOX1 is a direct target of HIF-1.
23713614 Data suggest that isoenzyme QSOX1A is secreted from mammalian cells despite transmembrane domain; QSOX1A is cleaved at internal sites and processed within Golgi apparatus to yield soluble enzyme that forms dimer upon cleavage of C-terminal domain.
23704371 QSOX1 activity was required for incorporation of laminin into the extracellular matrix (ECM) synthesized by fibroblasts, and ECM produced without QSOX1 was defective in supporting cell-matrix adhesion.
23680167 these studies suggest that QSOX1 is a predictive biomarker for luminal cancers and that it may be a useful target for elusive luminal B disease
23536962 High levels of QSOX1 RNA expression is associated with breast cancer.
More...

AA Sequence

MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWC      1 - 70
GHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAG     71 - 140
ADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQH    141 - 210
KGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAP    211 - 280
TTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNF    281 - 350
LHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAAR    351 - 420
QNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAG    421 - 490
APSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAA    491 - 560
APELAMGALELESRNSTLDPGKPEMMKSPTNTTPHVPAEGPEASRPPKLHPGLRAAPGQEPPEHMAELQR    561 - 630
NEQEQPLGQWHLSKRDTGAALLAESRAEKNRLWGPLEVRRVGRSSKQLVDIPEGQLEARAGRGRGQWLQV    631 - 700
LGGGFSYLDISLCVGLYSLSFMGLLAMYTYFQAKIRALKGHAGHPAA                           701 - 747
//

Text Mined References (45)

PMID Year Title
26158899 2015 Ebselen inhibits QSOX1 enzymatic activity and suppresses invasion of pancreatic and renal cancer cell lines.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25908093 2015 Immunohistochemical expression of sulfhydryl oxidase (QSOX1) in pediatric medulloblastomas.
24704990 2014 Expression level of quiescin sulfhydryl oxidase 1 (QSOX1) in neuroblastomas.
24475161 2014 QSOX1 inhibits autophagic flux in breast cancer cells.
24468475 2014 Disulfide bond generation in mammalian blood serum: detection and purification of quiescin-sulfhydryl oxidase.
24359107 2014 The emerging role of QSOX1 in cancer.
24008827 2013 HIF1 contributes to hypoxia-induced pancreatic cancer cells invasion via promoting QSOX1 expression.
23713614 2013 Proteolytic processing of QSOX1A ensures efficient secretion of a potent disulfide catalyst.
More...