Property Summary

NCBI Gene PubMed Count 43
PubMed Score 36.90
PubTator Score 47.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 1.078 1.9e-02
active ulcerative colitis 2.157 4.6e-03
adult high grade glioma -1.600 1.8e-06
Astrocytoma, Pilocytic 1.200 1.2e-06
atypical teratoid / rhabdoid tumor -1.300 4.3e-06
Breast cancer -1.400 4.7e-07
ependymoma -1.200 1.2e-07
fibroadenoma 1.400 1.7e-03
glioblastoma -1.100 2.9e-06
interstitial cystitis -2.200 3.2e-04
intraductal papillary-mucinous adenoma (... 1.500 8.0e-05
intraductal papillary-mucinous carcinoma... 1.500 7.9e-05
invasive ductal carcinoma 1.500 1.7e-02
lung carcinoma -1.300 3.0e-13
malignant mesothelioma -1.600 4.8e-07
medulloblastoma, large-cell -1.700 5.3e-06
osteosarcoma -1.871 1.1e-06
pancreatic ductal adenocarcinoma liver m... 1.131 3.5e-02
primitive neuroectodermal tumor -1.200 1.7e-03
psoriasis 1.400 2.6e-12
sonic hedgehog group medulloblastoma 1.200 3.1e-04
spina bifida -1.753 3.6e-02

 GWAS Trait (1)

 CSPA Cell Line (1)

Gene RIF (20)

AA Sequence

MRRCNSGSGPPPSLLLLLLWLLAVPGANAAPRSALYSPSDPLTLLQADTVRGAVLGSRSAWAVEFFASWC      1 - 70
GHCIAFAPTWKALAEDVKAWRPALYLAALDCAEETNSAVCRDFNIPGFPTVRFFKAFTKNGSGAVFPVAG     71 - 140
ADVQTLRERLIDALESHHDTWPPACPPLEPAKLEEIDGFFARNNEEYLALIFEKGGSYLGREVALDLSQH    141 - 210
KGVAVRRVLNTEANVVRKFGVTDFPSCYLLFRNGSVSRVPVLMESRSFYTAYLQRLSGLTREAAQTTVAP    211 - 280
TTANKIAPTVWKLADRSKIYMADLESALHYILRIEVGRFPVLEGQRLVALKKFVAVLAKYFPGRPLVQNF    281 - 350
LHSVNEWLKRQKRNKIPYSFFKTALDDRKEGAVLAKKVNWIGCQGSEPHFRGFPCSLWVLFHFLTVQAAR    351 - 420
QNVDHSQEAAKAKEVLPAIRGYVHYFFGCRDCASHFEQMAAASMHRVGSPNAAVLWLWSSHNRVNARLAG    421 - 490
APSEDPQFPKVQWPPRELCSACHNERLDVPVWDVEATLNFLKAHFSPSNIILDFPAAGSAARRDVQNVAA    491 - 560
APELAMGALELESRNSTLDPGKPEMMKSPTNTTPHVPAEGPEASRPPKLHPGLRAAPGQEPPEHMAELQR    561 - 630
NEQEQPLGQWHLSKRDTGAALLAESRAEKNRLWGPLEVRRVGRSSKQLVDIPEGQLEARAGRGRGQWLQV    631 - 700
LGGGFSYLDISLCVGLYSLSFMGLLAMYTYFQAKIRALKGHAGHPAA                           701 - 747
//

Text Mined References (46)

PMID Year Title