Property Summary

NCBI Gene PubMed Count 81
Grant Count 3
Funding $226,186.29
PubMed Score 247.33
PubTator Score 98.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 5.800 0.000
psoriasis 3.000 0.000
cystic fibrosis 2.244 0.000
Atopic dermatitis 1.300 0.004
non-small cell lung cancer 2.873 0.000
spina bifida -3.137 0.040
head and neck cancer and chronic obstruc... -1.100 0.050

Synonym

Accession O00358 O75765 Q5T109 Q99526
Symbols TTF2
FOXE2
HFKH4
HFKL5
NMTC4
TITF2
TTF-2
FKHL15

Gene

 GO Component (1)

Gene RIF (73)

PMID Text
26722557 Our findings suggest that FOXE1 variations generate a higher risk for poor histopathological features of papillary thyroid carcinoma
26206751 genetic susceptibility to thyroid cancer seems likely to be associated with the risk alleles at rs1867277, rs965513, rs1443434, and rs907580
26013125 In pancreatic cancer cells, AF6 is expressed at reduced levels, causing Dvl2 to be upregulated and available to bind and enhance FOXE1-induced trans-activation of Snail, which promotes proliferation and metastasis.
25950909 analysis of novel somatic mutations of FOXE1 in papillary thyroid cancer
25652407 Causal mutations for orofacial clefting and thyroid diseases occur within cis-regulatory elements at the human FOXE1 locus.
25538088 our data suggest that SYNE1 and FOXE1 are promising markers for colorectal cancer detection.
25381600 FOXE1 germline rare variant is involved in familal non-medullary thyroid carcinoma.
25303483 Our data suggest a role for PTCSC2, FOXE1, and TSHR in the predisposition to papillary thyroid carcinoma.
25251503 critical role in the regulation of hepatocellular carcinoma development
24852370 Findings suggest that the SNPs in XKR4 and near FOXE1 are involved in the regulation of TSH levels.
More...

AA Sequence

MTAESGPPPPQPEVLATVKEERGETAAGAGVPGEATGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAP      1 - 70
ERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMFESG     71 - 140
SFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAAAAAAIFPGAVPAARPPYPGAVYAGYAPPSLAAPPP    141 - 210
VYYPAASPGPCRVFGLVPERPLSPELGPAPSGPGGSCAFASAGAPATTTGYQPAGCTGARPANPSAYAAA    211 - 280
YAGPDGAYPQGAGSAIFAAAGRLAGPASPPAGGSSGGVETTVDFYGRTSPGQFGALGACYNPGGQLGGAS    281 - 350
AGAYHARHAAAYPGGIDRFVSAM                                                   351 - 373
//

Text Mined References (82)

PMID Year Title
26722557 2015 The investigation of foxe1 variations in papillary thyroid carcinoma.
26206751 2015 TITF1 and TITF2 loci variants indicate significant associations with thyroid cancer.
26013125 2015 Loss of polarity protein AF6 promotes pancreatic cancer metastasis by inducing Snail expression.
25950909 2015 Somatic Mutations of FOXE1 in Papillary Thyroid Cancer.
25652407 2015 A single nucleotide polymorphism associated with isolated cleft lip and palate, thyroid cancer and hypothyroidism alters the activity of an oral epithelium and thyroid enhancer near FOXE1.
25538088 2015 Spectrin repeat containing nuclear envelope 1 and forkhead box protein E1 are promising markers for the detection of colorectal cancer in blood.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25381600 2015 Identification of a novel germline FOXE1 variant in patients with familial non-medullary thyroid carcinoma (FNMTC).
25303483 2015 Genetic predisposition to papillary thyroid carcinoma: involvement of FOXE1, TSHR, and a novel lincRNA gene, PTCSC2.
25251503 2015 Double-negative feedback loop between microRNA-422a and forkhead box (FOX)G1/Q1/E1 regulates hepatocellular carcinoma tumor growth and metastasis.
More...