Property Summary

NCBI Gene PubMed Count 93
PubMed Score 254.89
PubTator Score 98.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Atopic dermatitis 1.300 4.0e-03
cystic fibrosis 2.244 4.0e-06
head and neck cancer and chronic obstruc... -1.100 5.0e-02
malignant mesothelioma 5.800 5.3e-10
non-small cell lung cancer 2.689 1.0e-09
psoriasis 1.100 2.0e-07
spina bifida -3.137 4.0e-02

 GO Component (1)

Gene RIF (85)

AA Sequence

MTAESGPPPPQPEVLATVKEERGETAAGAGVPGEATGRGAGGRRRKRPLQRGKPPYSYIALIAMAIAHAP      1 - 70
ERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMFESG     71 - 140
SFLRRRKRFKRSDLSTYPAYMHDAAAAAAAAAAAAAAAAIFPGAVPAARPPYPGAVYAGYAPPSLAAPPP    141 - 210
VYYPAASPGPCRVFGLVPERPLSPELGPAPSGPGGSCAFASAGAPATTTGYQPAGCTGARPANPSAYAAA    211 - 280
YAGPDGAYPQGAGSAIFAAAGRLAGPASPPAGGSSGGVETTVDFYGRTSPGQFGALGACYNPGGQLGGAS    281 - 350
AGAYHARHAAAYPGGIDRFVSAM                                                   351 - 373
//

Text Mined References (94)

PMID Year Title