Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
R01 Count 8
Funding $577,678.32
PubMed Score 23.84
PubTator Score 13.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis -1.247 0.010
malignant mesothelioma 1.100 0.000
Barrett's esophagus 2.800 0.050
osteosarcoma -1.336 0.019
intraductal papillary-mucinous adenoma (... 5.700 0.001
intraductal papillary-mucinous neoplasm ... 5.500 0.009
colon cancer 4.300 0.000
lung cancer -1.200 0.004
active ulcerative colitis 3.300 0.025
pancreatic cancer 2.600 0.000
lung adenocarcinoma 2.000 0.000
COPD 1.500 0.026
lung carcinoma -1.700 0.000
ovarian cancer 2.500 0.001

Synonym

Accession O00338 B2R813 Q53SG4 ST1C2
Symbols ST1C1
ST1C2
SULT1C1
humSULTC2

Gene

PANTHER Protein Class (1)

PDB

3BFX  

Gene RIF (8)

PMID Text
24335393 Our findings are the first to characterize the regulation of human SULT1C2 and SULT1C3 expression by several transcription factor activators.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
16804942 crystal structures of two members of SULT1 family, SULT1B1 and SULT1C1, both in complex with the product of the PAPS cofactor, adenosine-3-5-diphosphate (PAP).
16507781 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11740338 gene resequencing and functional genomic studies

AA Sequence

MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEK      1 - 70
CQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSY     71 - 140
YHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQ    141 - 210
FMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEI    211 - 280
YRRKMEGTSINFCMEL                                                          281 - 296
//

Text Mined References (31)

PMID Year Title
24335393 2014 Regulation of human cytosolic sulfotransferases 1C2 and 1C3 by nuclear signaling pathways in LS180 colorectal adenocarcinoma cells.
24028175 2013 Expression of the sulfotransferase 1C family: implications for xenobiotic toxicity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20056724 2010 Phase II metabolism of hesperetin by individual UDP-glucuronosyltransferases and sulfotransferases and rat and human tissue samples.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19548878 2009 Inhibitory effects of kynurenic acid, a tryptophan metabolite, and its derivatives on cytosolic sulfotransferases.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
More...