Property Summary

NCBI Gene PubMed Count 42
Grant Count 7
R01 Count 5
Funding $298,820.34
PubMed Score 72.17
PubTator Score 81.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.260 0.010

Gene RIF (32)

PMID Text
25890497 ErbB2 modulates gemcitabine and irinotecan/SN-38 chemoresistance of human pancreatic cancer cells via hCNT1 transporter and multidrug-resistance associated protein MRP-2.
25600708 hCNT1 is a putative determinant for nucleoside analog chemoresistance in ovarian cancer.
23722537 Human CNT1 fits the profile of a transceptor in a substrate translocation-independent manner and is likely to be relevant to tumor biology.
22644860 CNT1-mediated gemcitabine uptake shows a higher correlation with the CNT1 expression level than does ENT1-mediated uptake with ENT1 expression.
22580602 MUC4 and hCNT1 as potential targets to ameliorate the response of pancreatic tumors to gemcitabine treatment.
21998139 Site-directed mutagenesis analysis reveals that only one sodium binding site is affected by a mutation; lack of serine546 residue is responsible for apparent loss of CNT1 function.
21343396 our findings identify hCNT1 as a potential candidate to render drug-resistant pancreatic cancer cells amenable to chemotherapy.
20854794 Two pyrimidine nucleoside analogs were potent inhibitors of CNT1, with negligible transportability and little apparent cytotoxicity, suggesting that they may have utility as cytoprotective agents.
20734919 variability in hCNT1 and hENT1 expression in tumour and normal human breast tissue with different expression patterns related to patient prognosis and clinical outcome.
20665488 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MENDPSRRRESISLTPVAKGLENMGADFLESLEEGQLPRSDLSPAEIRSSWSEAAPKPFSRWRNLQPALR      1 - 70
ARSFCREHMQLFRWIGTGLLCTGLSAFLLVACLLDFQRALALFVLTCVVLTFLGHRLLKRLLGPKLRRFL     71 - 140
KPQGHPRLLLWFKRGLALAAFLGLVLWLSLDTSQRPEQLVSFAGICVFVALLFACSKHHCAVSWRAVSWG    141 - 210
LGLQFVLGLLVIRTEPGFIAFEWLGEQIRIFLSYTKAGSSFVFGEALVKDVFAFQVLPIIVFFSCVISVL    211 - 280
YHVGLMQWVILKIAWLMQVTMGTTATETLSVAGNIFVSQTEAPLLIRPYLADMTLSEVHVVMTGGYATIA    281 - 350
GSLLGAYISFGIDATSLIAASVMAAPCALALSKLVYPEVEESKFRREEGVKLTYGDAQNLIEAASTGAAI    351 - 420
SVKVVANIAANLIAFLAVLDFINAALSWLGDMVDIQGLSFQLICSYILRPVAFLMGVAWEDCPVVAELLG    421 - 490
IKLFLNEFVAYQDLSKYKQRRLAGAEEWVGDRKQWISVRAEVLTTFALCGFANFSSIGIMLGGLTSMVPQ    491 - 560
RKSDFSQIVLRALFTGACVSLVNACMAGILYMPRGAEVDCMSLLNTTLSSSSFEIYQCCREAFQSVNPEF    561 - 630
SPEALDNCCRFYNHTICAQ                                                       631 - 649
//

Text Mined References (46)

PMID Year Title
25890497 2015 The oncogenic receptor ErbB2 modulates gemcitabine and irinotecan/SN-38 chemoresistance of human pancreatic cancer cells via hCNT1 transporter and multidrug-resistance associated protein MRP-2.
25600708 2015 Defective hCNT1 transport contributes to gemcitabine chemoresistance in ovarian cancer subtypes: overcoming transport defects using a nanoparticle approach.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23722537 2013 Concentrative nucleoside transporter 1 (hCNT1) promotes phenotypic changes relevant to tumor biology in a translocation-independent manner.
22644860 2012 Variability of gemcitabine accumulation and its relationship to expression of nucleoside transporters in peripheral blood mononuclear cells.
22580602 2013 The MUC4 mucin mediates gemcitabine resistance of human pancreatic cancer cells via the Concentrative Nucleoside Transporter family.
22005931 2012 Genome-wide association analysis of age-at-onset in Alzheimer's disease.
21998139 2012 Functional analysis of the human concentrative nucleoside transporter-1 variant hCNT1S546P provides insight into the sodium-binding pocket.
21343396 2011 CNT1 expression influences proliferation and chemosensitivity in drug-resistant pancreatic cancer cells.
20854794 2011 Interaction of fused-pyrimidine nucleoside analogs with human concentrative nucleoside transporters: High-affinity inhibitors of human concentrative nucleoside transporter 1.
More...